SitesBLAST
Comparing BWI76_RS13715 FitnessBrowser__Koxy:BWI76_RS13715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
49% identity, 98% coverage: 4:333/338 of query aligns to 4:337/337 of 1krhA
- active site: C306 (= C302)
- binding flavin-adenine dinucleotide: Y143 (= Y139), R155 (= R151), S156 (≠ A152), Y157 (= Y153), S158 (= S154), V171 (≠ L167), V172 (≠ I168), G178 (= G174), K179 (≠ L175), M180 (= M176), S181 (= S177), T219 (= T215), E332 (= E328), F334 (= F330), S335 (≠ I331), A336 (= A332), N337 (≠ S333)
- binding fe2/s2 (inorganic) cluster: M38 (= M38), D39 (= D39), C40 (= C40), R41 (≠ S41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), C82 (= C81)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
33% identity, 98% coverage: 1:330/338 of query aligns to 1:330/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
34% identity, 93% coverage: 15:330/338 of query aligns to 9:329/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y139), R144 (= R151), Q145 (≠ A152), Y146 (= Y153), S147 (= S154), H161 (vs. gap), V162 (≠ I168), V165 (= V171), G168 (= G174), V169 (≠ L175), A170 (≠ M176), T171 (≠ S177), T214 (= T215), F329 (= F330)
- binding fe2/s2 (inorganic) cluster: C34 (= C40), N35 (≠ S41), G37 (= G43), C39 (= C45), G40 (= G46), C42 (= C48), C74 (= C81)
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
29% identity, 98% coverage: 2:331/338 of query aligns to 1:326/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C40), S38 (≠ D42), W57 (≠ G60), Y135 (= Y139), R146 (= R151), A147 (= A152), Y148 (= Y153), S149 (= S154), I162 (≠ L167), V163 (≠ I168), G169 (= G174), K170 (≠ L175), V171 (≠ M176), S172 (= S177), S209 (≠ T215), F325 (= F330)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ M38), C36 (= C40), N37 (≠ S41), G39 (= G43), C41 (= C45), G42 (= G46), C44 (= C48), C76 (= C81)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
29% identity, 97% coverage: 3:331/338 of query aligns to 2:326/326 of Q03304
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
31% identity, 70% coverage: 100:336/338 of query aligns to 1:250/250 of 1tvcA
- active site: Y63 (= Y153), S64 (= S154), L215 (= L301)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ T120), F49 (≠ Y139), R61 (= R151), S62 (≠ A152), Y63 (= Y153), S64 (= S154), L78 (= L167), I79 (= I168), R80 (= R169), L82 (≠ V171), F87 (≠ M176), G128 (= G216), N155 (≠ T243), E159 (≠ D247), S186 (≠ V269), G187 (≠ V270), E242 (= E328), F244 (= F330), L245 (≠ I331)
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
30% identity, 93% coverage: 19:331/338 of query aligns to 19:334/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
30% identity, 93% coverage: 19:331/338 of query aligns to 18:321/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C40), S41 (≠ D42), W60 (≠ D61), R152 (= R151), A153 (= A152), Y154 (= Y153), S155 (= S154), Y169 (≠ L167), I170 (= I168), G176 (= G174), R177 (≠ L175), F178 (≠ M176), S179 (= S177), A218 (≠ T215), F320 (= F330), F321 (≠ I331)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ M38), C39 (= C40), A40 (≠ S41), G42 (= G43), C44 (= C45), G45 (= G46), C47 (= C48), C80 (= C81)
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 93% coverage: 19:331/338 of query aligns to 18:306/306 of 7c3bB
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
33% identity, 59% coverage: 132:330/338 of query aligns to 32:235/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y139), R55 (= R151), Q56 (≠ A152), Y57 (= Y153), S58 (= S154), S71 (≠ L167), V72 (≠ I168), E75 (vs. gap), N81 (≠ V171), G83 (= G173), L84 (= L175), V85 (≠ M176), S86 (= S177), T127 (≠ A218), E233 (= E328), F235 (= F330)
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
30% identity, 51% coverage: 151:321/338 of query aligns to 83:269/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (= A152), Y85 (= Y153), S86 (= S154), N100 (≠ L167), A104 (vs. gap), S105 (vs. gap), L112 (≠ V171), P113 (= P172), G115 (= G174), Q116 (≠ L175), M117 (= M176), S118 (= S177), A155 (≠ T215)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R169), G154 (= G214), G182 (= G241), F226 (= F282), I227 (≠ V283), P252 (= P304), M255 (= M307)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
30% identity, 51% coverage: 151:321/338 of query aligns to 83:269/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (= A152), Y85 (= Y153), S86 (= S154), N100 (≠ L167), A104 (vs. gap), L112 (≠ V171), P113 (= P172), G115 (= G174), Q116 (≠ L175), M117 (= M176), S118 (= S177), A155 (≠ T215)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (≠ E255), W207 (= W266), H208 (≠ L267), L209 (≠ P268)
Sites not aligning to the query:
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
30% identity, 59% coverage: 132:330/338 of query aligns to 183:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ A152), Y208 (= Y153), S209 (= S154), S222 (≠ L167), V223 (≠ I168), K224 (≠ R169), E226 (vs. gap), P232 (= P172), G234 (= G174), Y235 (≠ L175), V236 (≠ M176), S237 (= S177), V276 (≠ T215), T279 (≠ A218), V395 (≠ K329), F396 (= F330)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
30% identity, 59% coverage: 132:330/338 of query aligns to 183:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ A152), Y208 (= Y153), S209 (= S154), S222 (≠ L167), V223 (≠ I168), K224 (≠ R169), E226 (vs. gap), P232 (= P172), G234 (= G174), Y235 (≠ L175), V236 (≠ M176), S237 (= S177), V276 (≠ T215), T279 (≠ A218), F396 (= F330)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
30% identity, 59% coverage: 132:330/338 of query aligns to 183:396/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ A152), Y208 (= Y153), S209 (= S154), S222 (≠ L167), V223 (≠ I168), K224 (≠ R169), E226 (vs. gap), P232 (= P172), G234 (= G174), Y235 (≠ L175), V236 (≠ M176), S237 (= S177), E394 (= E328), V395 (≠ K329)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
30% identity, 59% coverage: 132:330/338 of query aligns to 183:396/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
30% identity, 59% coverage: 132:330/338 of query aligns to 183:396/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (= Y139), R206 (= R151), Q207 (≠ A152), Y208 (= Y153), S209 (= S154), S222 (≠ L167), E226 (vs. gap), Q231 (≠ V171), P232 (= P172), G234 (= G174), Y235 (≠ L175), V236 (≠ M176), S237 (= S177), V395 (≠ K329)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
23% identity, 78% coverage: 66:330/338 of query aligns to 95:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y139), R209 (= R151), A210 (= A152), Y211 (= Y153), S212 (= S154), A230 (vs. gap), P233 (vs. gap), V239 (vs. gap), P240 (= P172), G242 (= G174), Q243 (≠ L175), M244 (= M176), A282 (≠ T215), F405 (= F330)
- binding fe2/s2 (inorganic) cluster: C110 (= C81)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S154), R228 (vs. gap), G281 (= G214), A282 (≠ T215), G309 (= G241), R311 (≠ T243), S339 (≠ A271), F353 (= F282), C377 (= C302), G378 (= G303), P379 (= P304), M381 (≠ P306), M382 (= M307), D403 (≠ E328)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
23% identity, 78% coverage: 66:330/338 of query aligns to 96:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R151), A211 (= A152), Y212 (= Y153), S213 (= S154), V228 (= V171), R229 (vs. gap), A231 (vs. gap), V240 (vs. gap), P241 (= P172), G243 (= G174), Q244 (≠ L175), M245 (= M176)
- binding fe2/s2 (inorganic) cluster: C111 (= C81)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
23% identity, 78% coverage: 66:330/338 of query aligns to 96:406/408 of A5F5Y4
- C111 (= C81) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R151) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (= Y153) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (= S177) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
Query Sequence
>BWI76_RS13715 FitnessBrowser__Koxy:BWI76_RS13715
MTFNIALNFEDGITRFIQCHAGEKVLDAAYRQQVNLPMDCSDGVCGTCKCRCVSGEYGLG
DDFLEEALSEDEAAERQVLTCQMVPTSDCVIDVPAAAAQCKTALASLGAAVKQVNLLSDT
AIELVVVLDEPLDFLPGQYINIEVPGTPQARAYSFSSLPGSREGSFLIRNVPGGLMSQWL
TQRASPGDRLTLSGPMGSFYLRGGERPLLLLAGGTGLAPLLSMLQTLVMQRSTRPVTLLY
GVTRDCDLVKTDALEAFTGQLPAYRWLPVVADAQSGCPQRGFVTEHLDDAILNDGDVDIY
LCGPPPMVNAVATALRERGVSPAGFWYEKFIASQSAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory