Comparing BWI76_RS14015 FitnessBrowser__Koxy:BWI76_RS14015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
41% identity, 96% coverage: 19:486/490 of query aligns to 19:463/468 of 5o5cB
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
30% identity, 98% coverage: 6:487/490 of query aligns to 2:487/487 of 2jisB
6enzA Crystal structure of mouse gadl1 (see paper)
29% identity, 94% coverage: 25:487/490 of query aligns to 38:487/487 of 6enzA
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
29% identity, 94% coverage: 25:487/490 of query aligns to 96:550/550 of Q80WP8
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Ruminococcus gnavus (strain ATCC 29149 / VPI C7-9) (see paper)
29% identity, 84% coverage: 81:490/490 of query aligns to 91:486/490 of A7B1V0
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
29% identity, 84% coverage: 81:490/490 of query aligns to 76:468/471 of 4obvC
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
29% identity, 84% coverage: 81:490/490 of query aligns to 76:458/462 of 4obuA
6zekA Crystal structure of mouse csad (see paper)
30% identity, 94% coverage: 26:487/490 of query aligns to 28:476/476 of 6zekA
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
33% identity, 86% coverage: 62:484/490 of query aligns to 59:469/470 of 4rlgD
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
30% identity, 84% coverage: 74:487/490 of query aligns to 84:502/504 of 2okjB
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
30% identity, 84% coverage: 74:487/490 of query aligns to 176:594/594 of Q99259
Sites not aligning to the query:
4rizC The crystal structure of y333q mutant pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
34% identity, 86% coverage: 62:484/490 of query aligns to 63:474/476 of 4rizC
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
30% identity, 84% coverage: 74:485/490 of query aligns to 84:500/500 of 3vp6A
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
29% identity, 84% coverage: 74:487/490 of query aligns to 167:585/585 of Q05329
Sites not aligning to the query:
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 84% coverage: 74:487/490 of query aligns to 167:585/585 of Q05683
Sites not aligning to the query:
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
29% identity, 84% coverage: 74:486/490 of query aligns to 80:483/483 of 2okkA
A0A2I6B3P0 4-hydroxyphenylacetaldehyde synthase; HPAA synthase; Rr4HPAAS; RrHPAAS; EC 4.1.1.108 from Rhodiola rosea (Roseroot) (Sedum rhodiola) (see paper)
27% identity, 77% coverage: 113:489/490 of query aligns to 120:490/490 of A0A2I6B3P0
6khpA Crystal structure of oryza sativa tdc with plp and tryptamine (see paper)
28% identity, 80% coverage: 99:488/490 of query aligns to 94:489/490 of 6khpA
Sites not aligning to the query:
6khnA Crystal structure of oryza sativa tdc with plp and serotonin (see paper)
28% identity, 80% coverage: 99:488/490 of query aligns to 94:489/490 of 6khnA
Sites not aligning to the query:
7xinA Crystal structure of dodc from pseudomonas
30% identity, 72% coverage: 113:463/490 of query aligns to 104:442/470 of 7xinA
Sites not aligning to the query:
>BWI76_RS14015 FitnessBrowser__Koxy:BWI76_RS14015
MSKLNPILAGSAQSIDAYQQAIAQTSQAVAQWLQQPEMYQGKSVDELRERITLDFNEQGL
GNQAAIERAIEYFLKDSLSVHHPQCVAHLHCPSLVISQAAEVLINATNQSMDSWDQSPSA
TIIEIKLIEWLRAQVGYGAGDAGVFTSGGTQSNMMGLMLARDAFFARRGHSIQQDGLPGD
IRQYKVLCSENAHFSVQKNMALMGLGYRSVTLVKTDEFARMDVADLKAKIAEAQANGEQI
MAIVATAGTTDAGAIDPLREIAAVAAEHQIWLHVDAAWGGALLMSEKYRDRLDGIELVDS
ITLDFHKQFFQTISCGAFLLKEARHYELMRYQAAYLNSEFDEEHGVPNLVSKSLQTTRRF
DALKLWMGLEALGQKQYAEIIDHGVTMALNVADYVATQPTLELVMQPQLASVLFRSRPQQ
MAGSDDAAIALLNQRVGDALLASGRANVGVTEHNGVTCLKLTLLNPIVTLEDVKVLLSLV
ERTAQELLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory