Comparing BWI76_RS14455 FitnessBrowser__Koxy:BWI76_RS14455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 96% coverage: 10:437/447 of query aligns to 28:445/448 of 6io1B
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 94% coverage: 15:436/447 of query aligns to 36:454/460 of 5kr6B
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 97% coverage: 13:446/447 of query aligns to 70:501/504 of Q94CE5
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 95% coverage: 15:437/447 of query aligns to 32:451/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 95% coverage: 15:437/447 of query aligns to 35:452/458 of 5kr3A
5ghgB Transaminase w58l with smba
36% identity, 97% coverage: 13:444/447 of query aligns to 27:433/433 of 5ghgB
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 96% coverage: 10:437/447 of query aligns to 22:445/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 96% coverage: 10:437/447 of query aligns to 24:447/449 of 5lh9D
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 96% coverage: 15:442/447 of query aligns to 31:449/450 of 6gwiB
Sites not aligning to the query:
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 95% coverage: 15:437/447 of query aligns to 34:453/459 of 5kquC
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
35% identity, 95% coverage: 15:437/447 of query aligns to 32:446/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
35% identity, 95% coverage: 15:437/447 of query aligns to 32:446/455 of 7ypnD
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
32% identity, 96% coverage: 13:442/447 of query aligns to 27:451/459 of D6R3B6
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
33% identity, 96% coverage: 13:439/447 of query aligns to 26:446/453 of 6g4dB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
33% identity, 96% coverage: 13:439/447 of query aligns to 26:446/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
33% identity, 96% coverage: 13:439/447 of query aligns to 26:446/451 of 6g4eA
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
33% identity, 94% coverage: 13:433/447 of query aligns to 31:446/453 of 6s54A
Sites not aligning to the query:
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
34% identity, 96% coverage: 10:437/447 of query aligns to 22:436/444 of 3i5tA
Sites not aligning to the query:
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
32% identity, 93% coverage: 15:429/447 of query aligns to 35:447/458 of 3fcrA
Sites not aligning to the query:
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 93% coverage: 21:435/447 of query aligns to 35:435/443 of 6fyqA
Sites not aligning to the query:
>BWI76_RS14455 FitnessBrowser__Koxy:BWI76_RS14455
MSQIIHRSLRTTPAVAVSAQGAYITDASGQRYLDACGGAAVSCLGHAHPDVLAAMHRQID
RLAYAHTSFFTSDTVEQLAEQLVRTAPGSLNYAYFVSGGSEAVETALKLARQYFVEIGQP
DRTLFIARKQSYHGNTLGALAVGGNEWRRRQFAPLLMDVVRVSACNEYRDREAGESQQQY
TERLLGELEAAILDAGPEKIIGFIAETVVGATTGAMPPTPGYLQGVRRLCDKYGILYIAD
EVMCGMGRTGTLHAFEQDGVVPDIVTIAKGLGGGYQPIGAVLASEQIVAALQAGSGMFQH
GHTYICHPTAAAAALAVQQVIERDRLLEQVQQQGAYLQQALHDVLGGLPYVGDTRGRGLF
AGVELVCDKERKTAFDPLLKLHAAIKAQCMGHGLLVYPMGGTIDGQRGDHILIAPPFIVS
RSELDFVVDTLHKVISEETHKLMRHQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory