Comparing BWI76_RS14600 FitnessBrowser__Koxy:BWI76_RS14600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 93% coverage: 11:252/260 of query aligns to 5:242/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 87% coverage: 11:237/260 of query aligns to 2:227/343 of P30750
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 87% coverage: 9:234/260 of query aligns to 1:219/241 of 4u00A
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 87% coverage: 11:237/260 of query aligns to 3:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 87% coverage: 11:237/260 of query aligns to 3:228/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 87% coverage: 11:237/260 of query aligns to 3:228/344 of 6cvlD
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 87% coverage: 11:237/260 of query aligns to 4:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 87% coverage: 11:237/260 of query aligns to 4:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 87% coverage: 11:237/260 of query aligns to 4:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 87% coverage: 11:237/260 of query aligns to 4:224/242 of 2oljA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 91% coverage: 15:250/260 of query aligns to 9:254/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 84% coverage: 15:232/260 of query aligns to 6:217/240 of 4ymuJ
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 85% coverage: 15:234/260 of query aligns to 9:233/253 of 1g9xB
2pmkA Crystal structures of an isolated abc-atpase in complex with tnp-adp (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 21:215/243 of 2pmkA
Sites not aligning to the query:
2ff7A The abc-atpase of the abc-transporter hlyb in the adp bound state (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 21:215/243 of 2ff7A
Sites not aligning to the query:
7sgrE Structure of hemolysin a secretion system hlyb/d complex (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 479:673/700 of 7sgrE
Sites not aligning to the query:
3b5jA Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 21:215/243 of 3b5jA
Sites not aligning to the query:
8dckA Structure of hemolysin a secretion system hlyb/d complex, atp-bound (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 474:668/691 of 8dckA
Sites not aligning to the query:
1xefA Crystal structure of the atp/mg2+ bound composite dimer of hlyb-nbd (see paper)
36% identity, 78% coverage: 26:227/260 of query aligns to 19:213/241 of 1xefA
Sites not aligning to the query:
4f4cA The crystal structure of the multi-drug transporter (see paper)
35% identity, 79% coverage: 23:228/260 of query aligns to 1036:1236/1250 of 4f4cA
Sites not aligning to the query:
>BWI76_RS14600 FitnessBrowser__Koxy:BWI76_RS14600
MQQPHTTPPRVEMINITKTYGSIRSLRGVNLELAPGEVLGLVGDNGAGKSTLTKVLSGAV
IPSGGTIRIDGEQQQFANPADSRRCHIEMVYQDLSLCDTVDVAGNLFMGREPMKSVLGIP
FLDEAKMHADAREMLKGLGISIPDTRLLVRNLSGGQRQAIAIARAAAFDPKVLIMDEPTA
ALAVAEVEAVLELIRRVSARGVSVILITHRLQDLFLVCDRIMVMYEGTNVADRRVADTSL
SDIVNLIVGEKFTARSAAAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory