Comparing BWI76_RS14620 FitnessBrowser__Koxy:BWI76_RS14620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7uoiA Crystallographic structure of dape from enterococcus faecium
29% identity, 99% coverage: 5:370/370 of query aligns to 11:383/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 94% coverage: 22:368/370 of query aligns to 28:377/380 of 7rsfA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
31% identity, 72% coverage: 2:269/370 of query aligns to 3:276/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
31% identity, 72% coverage: 2:269/370 of query aligns to 3:276/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
29% identity, 66% coverage: 26:269/370 of query aligns to 25:276/377 of 7t1qA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 72% coverage: 5:269/370 of query aligns to 10:280/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 72% coverage: 5:269/370 of query aligns to 6:276/377 of P44514
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
28% identity, 72% coverage: 4:269/370 of query aligns to 7:277/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
23% identity, 97% coverage: 4:362/370 of query aligns to 12:387/408 of Q03154
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 44% coverage: 5:165/370 of query aligns to 8:168/258 of 4h2kA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
24% identity, 97% coverage: 4:362/370 of query aligns to 12:386/407 of P37111
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
28% identity, 46% coverage: 63:234/370 of query aligns to 96:276/426 of 3pfoA
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
25% identity, 99% coverage: 1:365/370 of query aligns to 6:357/360 of 2f7vA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
25% identity, 99% coverage: 1:365/370 of query aligns to 5:362/366 of Q8P8J5
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
29% identity, 55% coverage: 51:252/370 of query aligns to 57:251/373 of 3rzaA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
29% identity, 45% coverage: 5:169/370 of query aligns to 6:170/265 of 4op4B
Sites not aligning to the query:
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
29% identity, 45% coverage: 25:189/370 of query aligns to 47:203/470 of P45494
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
29% identity, 45% coverage: 25:189/370 of query aligns to 47:203/468 of 1lfwA
Sites not aligning to the query:
5k8pA Zn2+/tetrahedral intermediate-bound r289a 5-nitroanthranilate aminohydrolase (see paper)
22% identity, 68% coverage: 19:271/370 of query aligns to 30:317/421 of 5k8pA
Sites not aligning to the query:
5k8nA 5naa-bound 5-nitroanthranilate aminohydrolase (see paper)
22% identity, 68% coverage: 19:271/370 of query aligns to 29:316/420 of 5k8nA
Sites not aligning to the query:
>BWI76_RS14620 FitnessBrowser__Koxy:BWI76_RS14620
MTTTLELARQLLGFNTINPPGSEADCMRYFADWLNANGFAVSLSSFGESRSNLIAWLPGA
TPGKPLAFTGHLDTVPLGNARWRYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVQQRE
TILAGRGAVLLITGGEETGCDGARALIASAPLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALAKIQHFSPGAPHPLMKQPTVNVGRIEGGLNINSV
PDRTRFDVDIRSAPDLQHATIRQRLTTLLGESVTVSTLVDLPAVLSEQDHAWIKQVYQRC
QPLHDRPLEPRVVPYFTDASLLLPALGNPPCIILGPGEPSMAHQTDEYCLLSRLEEAEQL
YGNLIRDWMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory