Comparing BWI76_RS14855 FitnessBrowser__Koxy:BWI76_RS14855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 86% coverage: 40:311/317 of query aligns to 3:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
34% identity, 90% coverage: 32:317/317 of query aligns to 3:284/284 of 7e7mC
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
31% identity, 88% coverage: 39:317/317 of query aligns to 3:289/292 of 2fn8A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
35% identity, 81% coverage: 39:296/317 of query aligns to 4:270/287 of 5dteB
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 97% coverage: 4:311/317 of query aligns to 1:307/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
30% identity, 86% coverage: 39:311/317 of query aligns to 4:275/315 of 4rsmA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 90% coverage: 28:311/317 of query aligns to 28:307/349 of A0QYB3
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
29% identity, 86% coverage: 39:311/317 of query aligns to 3:274/315 of 4rs3A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
29% identity, 86% coverage: 39:311/317 of query aligns to 3:274/314 of 5hkoA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
30% identity, 84% coverage: 46:311/317 of query aligns to 17:287/296 of 4irxA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
31% identity, 84% coverage: 50:314/317 of query aligns to 18:287/289 of 5hqjA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 87% coverage: 40:315/317 of query aligns to 9:284/287 of 4yo7A
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
27% identity, 81% coverage: 40:297/317 of query aligns to 4:260/271 of 1dbpA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
27% identity, 86% coverage: 39:311/317 of query aligns to 2:280/290 of 4wutA
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 87% coverage: 39:314/317 of query aligns to 4:290/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 87% coverage: 39:314/317 of query aligns to 4:290/297 of 4ry9A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
26% identity, 84% coverage: 40:305/317 of query aligns to 5:265/270 of 4zjpA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
30% identity, 84% coverage: 33:297/317 of query aligns to 3:278/303 of 5dkvA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
30% identity, 68% coverage: 49:262/317 of query aligns to 12:228/313 of 2h3hA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
33% identity, 69% coverage: 51:268/317 of query aligns to 18:248/302 of 5ocpA
Sites not aligning to the query:
>BWI76_RS14855 FitnessBrowser__Koxy:BWI76_RS14855
MTKLRKAWLAIAVAAVITTMTGLAPAASAAPQESKKIARIGLMVQDMSNPFFSAMERNAK
QAAAKIGATLNVQDAQVDLANQNTQIDAFIQQKVDLIIISAVDESGIEPAIQRAKAAGII
VIAVDTPAKGADAAIMTNAIQAGETSCEYLFSQMGGKGKVLLVDGTPIQTIIDRIKGCKN
VAQKYPDIKIVGQQASRNDRASGLMVTTDMLTANPDVSGIFGMNDPSALGAVLAVEQAGK
AGAINVTGVDGSPEAVEELKRGGSPFIGTATQNPGEMVRQAISLAQDMVDGKPIASRTVL
IPSVLVTRDNVGSYPGW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory