Comparing BWI76_RS14860 FitnessBrowser__Koxy:BWI76_RS14860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 96% coverage: 9:500/510 of query aligns to 4:496/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 46% coverage: 9:244/510 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 46% coverage: 9:245/510 of query aligns to 4:254/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 8:228/510 of query aligns to 1:217/241 of 4u00A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 47% coverage: 9:248/510 of query aligns to 4:232/285 of 4yerA
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 43% coverage: 9:225/510 of query aligns to 1:207/348 of 3d31A
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 8:222/510 of query aligns to 3:219/648 of P75831
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 43% coverage: 5:222/510 of query aligns to 13:224/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 43% coverage: 9:228/510 of query aligns to 3:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 43% coverage: 9:228/510 of query aligns to 3:219/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 43% coverage: 9:228/510 of query aligns to 3:219/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 43% coverage: 9:228/510 of query aligns to 3:219/242 of 2oljA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 45% coverage: 15:243/510 of query aligns to 32:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 45% coverage: 15:243/510 of query aligns to 32:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
30% identity, 42% coverage: 15:227/510 of query aligns to 32:246/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 43% coverage: 9:225/510 of query aligns to 1:215/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 44% coverage: 9:233/510 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 44% coverage: 9:233/510 of query aligns to 2:229/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 44% coverage: 9:233/510 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 44% coverage: 9:233/510 of query aligns to 2:229/344 of 3tuiC
>BWI76_RS14860 FitnessBrowser__Koxy:BWI76_RS14860
MADISSPPLLRLEGISKRYGATLALNNVRFDLFAGEVHALMGENGAGKSTLMKILSGNEQ
RDSGVIFIDGQAIDIRTPRDARKYGIAIIHQELNTVPDMTVAENLFLGQEPTSFAGILDR
KRMHREAKEKLNRINADIDPQAPLGSLSIGRQQMVEIARAVSENAKVLVLDEPTAALSRA
ETLQLYRLIAQMRQDGVGMVYISHRMEEVWQLANRVTVFRDGTWIGTENLGNVSTTDIVR
MMVGRQIVDLYQHEPRTPGDVLLEVRDLAGSATGPVSFEVSAGEVVSMSGLVGSGRTEVA
RLLFGADPRSQGSVRLAGRESQPSDPTAAIADGIGMVTEDRKTQGLFLGHSVEHNIDISS
LDNFVAGGVVKRKTIRAAVLEQMRRLRLRENAVELPVSALSGGNQQKAALARWLLRDSRL
LILDEPTRGVDIGAKREIYELIDRLARAGKAILVISSDLPEAIGISDRVLVMRGGRIVHQ
LPSCSATEEEVMLHATGTFTSQSGECHGQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory