SitesBLAST
Comparing BWI76_RS14900 FitnessBrowser__Koxy:BWI76_RS14900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
33% identity, 92% coverage: 9:314/331 of query aligns to 3:286/304 of 1wwkA
- active site: S96 (≠ N124), R230 (= R258), D254 (= D282), E259 (= E287), H278 (= H306)
- binding nicotinamide-adenine-dinucleotide: V100 (= V128), G146 (= G177), F147 (≠ L178), G148 (= G179), R149 (≠ H180), I150 (= I181), Y168 (= Y199), D169 (= D200), P170 (≠ K201), V201 (≠ A229), P202 (≠ R230), T207 (= T235), T228 (= T256), S229 (≠ A257), D254 (= D282), H278 (= H306), G280 (≠ A308)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 76% coverage: 64:314/331 of query aligns to 35:285/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 76% coverage: 64:314/331 of query aligns to 36:286/525 of 3ddnB
Sites not aligning to the query:
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 17:289/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N124), A100 (≠ V128), R149 (≠ H180), I150 (= I181), Y168 (= Y199), D169 (= D200), P170 (≠ K201), I171 (≠ Y202), H200 (= H228), T201 (≠ A229), P202 (≠ R230), T207 (= T235), C228 (≠ T256), A229 (= A257), R230 (= R258), H277 (= H306), G279 (≠ A308)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 18:290/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 17:289/297 of 6rj3A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 18:290/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V176), G147 (= G177), L148 (= L178), G149 (= G179), R150 (≠ H180), I151 (= I181), G152 (≠ A182), D170 (= D200), H201 (= H228), T202 (≠ A229), P203 (≠ R230)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 15:287/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G179), I148 (= I181), Y166 (= Y199), D167 (= D200), P168 (≠ K201), I169 (≠ Y202), I170 (≠ V203), H198 (= H228), T199 (≠ A229), L208 (= L238), R228 (= R258)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 18:290/302 of 6rihA
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 19:291/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ G100), A102 (≠ V128), G148 (= G177), R151 (≠ H180), I152 (= I181), Y170 (= Y199), D171 (= D200), P172 (≠ K201), I173 (≠ Y202), H202 (= H228), T203 (≠ A229), P204 (≠ R230), T209 (= T235), C230 (≠ T256), A231 (= A257), R232 (= R258), H279 (= H306), G281 (≠ A308)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 18:290/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 83% coverage: 43:318/331 of query aligns to 19:291/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
36% identity, 76% coverage: 69:318/331 of query aligns to 46:295/533 of O43175
- T78 (≠ G100) binding
- R135 (≠ K157) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ HI 180:181) binding
- D175 (= D200) binding
- T207 (≠ A229) binding
- CAR 234:236 (≠ TAR 256:258) binding
- D260 (= D282) binding
- V261 (≠ T283) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAG 306:309) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 76% coverage: 69:318/331 of query aligns to 36:281/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ H180), Y160 (= Y199), D161 (= D200), P162 (≠ K201), I164 (≠ V203), L179 (= L215), T193 (≠ A229), P194 (≠ R230), S198 (≠ E234), L202 (= L238)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 76% coverage: 64:314/331 of query aligns to 39:296/334 of 5aovA
- active site: L100 (≠ N124), R241 (= R258), D265 (= D282), E270 (= E287), H288 (= H306)
- binding glyoxylic acid: M52 (≠ Q77), L53 (≠ F78), L53 (≠ F78), Y74 (≠ L98), A75 (≠ R99), V76 (≠ G100), G77 (= G101), R241 (= R258), H288 (= H306)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ G100), T104 (≠ V128), F158 (≠ L178), G159 (= G179), R160 (≠ H180), I161 (= I181), S180 (≠ D200), R181 (≠ K201), A211 (≠ H228), V212 (≠ A229), P213 (≠ R230), T218 (= T235), I239 (≠ T256), A240 (= A257), R241 (= R258), H288 (= H306), G290 (≠ A308)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 95% coverage: 18:330/331 of query aligns to 67:368/466 of P87228
- S87 (≠ Q44) modified: Phosphoserine
- S258 (≠ T232) modified: Phosphoserine
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
31% identity, 73% coverage: 76:317/331 of query aligns to 51:306/330 of 1dxyA
- active site: S101 (≠ N124), R234 (= R258), D258 (= D282), E263 (= E287), H295 (= H306)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ G100), Y100 (≠ R123), Y298 (≠ G309)
- binding nicotinamide-adenine-dinucleotide: Y100 (≠ R123), G152 (= G177), G154 (= G179), H155 (= H180), I156 (= I181), Y174 (= Y199), D175 (= D200), P176 (≠ K201), H204 (= H228), V205 (≠ A229), P206 (≠ R230), N211 (≠ T235), T232 (= T256), A233 (= A257), R234 (= R258), H295 (= H306), Y298 (≠ G309)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
31% identity, 73% coverage: 76:317/331 of query aligns to 51:306/333 of P17584
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
32% identity, 80% coverage: 64:327/331 of query aligns to 38:308/332 of 6biiA
- active site: L99 (≠ N124), R240 (= R258), D264 (= D282), E269 (= E287), H287 (= H306)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ G100), T103 (≠ V128), G156 (= G177), F157 (≠ L178), G158 (= G179), R159 (≠ H180), I160 (= I181), A179 (≠ D200), R180 (≠ K201), S181 (≠ Y202), K183 (≠ A204), V211 (≠ A229), P212 (≠ R230), E216 (= E234), T217 (= T235), V238 (≠ T256), A239 (= A257), R240 (= R258), D264 (= D282), H287 (= H306), G289 (≠ A308)
7cvpA The crystal structure of human phgdh from biortus.
36% identity, 62% coverage: 114:318/331 of query aligns to 41:244/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G177), G103 (= G179), R104 (≠ H180), I105 (= I181), Y123 (= Y199), D124 (= D200), P125 (≠ K201), I126 (≠ Y202), H155 (= H228), T156 (≠ A229), P157 (≠ R230), T162 (= T235), C183 (≠ T256), A184 (= A257), R185 (= R258), H232 (= H306), G234 (≠ A308)
Query Sequence
>BWI76_RS14900 FitnessBrowser__Koxy:BWI76_RS14900
MKCLAIADLFINAAMMDAGLNALKDKGIAVEVREWSHESIEKLQEDNLLVEQQGSEALAL
PAALLQGAEETEILIVQFAPVNAAVFDKLPKLKYVGVLRGGIENVNQAEAKARGIEVMNT
PGRNARSVAEFTVGMILAEMRNIARSHDALRDKFWRKESPNHRAIPELGGKVVGLVGLGH
IAQLVAGFLRGFGSEIIFYDKYVAGHDSYEKVDSLDELVRRADVISLHARLTAETENLIN
AHHFDLMKESAIIVNTARSGLINEADLIAALRAGKIMGAALDTFDDEPLPDDSAFYSLNN
VTITPHIAGSTIDAFSNSPKLFSEILLKKIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory