Comparing BWI76_RS15085 FitnessBrowser__Koxy:BWI76_RS15085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
6bmcA The structure of a dimeric type ii dah7ps associated with pyocyanin biosynthesis in pseudomonas aeruginosa (see paper)
42% identity, 95% coverage: 12:382/389 of query aligns to 15:379/380 of 6bmcA
5uxnA Type ii dah7ps from pseudomonas aeruginosa with tyr bound (see paper)
33% identity, 94% coverage: 12:375/389 of query aligns to 14:429/445 of 5uxnA
5uxmA Type ii dah7ps from pseudomonas aeruginosa with trp bound (see paper)
33% identity, 94% coverage: 12:375/389 of query aligns to 14:429/445 of 5uxmA
5hudD Non-covalent complex of and dahp synthase and chorismate mutase from corynebacterium glutamicum with bound transition state analog (see paper)
34% identity, 94% coverage: 12:375/389 of query aligns to 31:444/457 of 5hudD
5hucA Dahp synthase from corynebacterium glutamicum (see paper)
34% identity, 94% coverage: 12:375/389 of query aligns to 23:436/449 of 5hucA
3pfpA Structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis in complex with an active site inhibitor (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 34:451/464 of 3pfpA
3nv8B The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase in complex with phosphoenol pyruvate and manganese (thesit-free) (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 34:451/464 of 3nv8B
5e40A 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis with d-tyrosine bound in the phenylalanine binding site (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 32:449/462 of 5e40A
5e2lA 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis in complex with d-phenylalanine (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 32:449/462 of 5e2lA
O53512 Phospho-2-dehydro-3-deoxyheptonate aldolase AroG; 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase; DAHP synthase; Phospho-2-keto-3-deoxyheptonate aldolase; EC 2.5.1.54 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 32:449/462 of O53512
2ypqA 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase with tryptophan and tyrosine bound (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 30:447/460 of 2ypqA
2yppA 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase in complex with 3 tyrosine molecules (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 30:447/460 of 2yppA
5e5gA 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase with d-tryptophan bound in the tryptophan and phenylalanine binding sites (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 28:445/458 of 5e5gA
2ypoA 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase with phenylalanine bound in only one site (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 28:445/458 of 2ypoA
2b7oA The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis (see paper)
32% identity, 95% coverage: 8:375/389 of query aligns to 34:438/451 of 2b7oA
3nueB The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with tryptophan (see paper)
31% identity, 95% coverage: 8:375/389 of query aligns to 34:430/443 of 3nueB
>BWI76_RS15085 FitnessBrowser__Koxy:BWI76_RS15085
MTSFPGNKSNWQQPFWSDKDMLALVISELDTLPELLSFEEISEFNKALAAVYAGKAMIFQ
AGDCAERICESDALHVRKKLTFLEQMSRELSTLMGLPILTVGRIAGQYAKPRSQHNEVDG
DRVLPVWRGDSVNRPEATPEARRNDPQRMLLSYHAAAETLAEIKRYEREYPRDVHPIWTS
HEALLLDYETTQIRTNPHGESYLASTHWPWIGIRTLAPDSPHIAMLANIANPVACKIDAT
VTPSFIATLCRQLNPQRIPGRLTFISRFGRSHIHRLGALIQAAQATETPVLWMCDPMHGN
TGKTQAGNKRRELSDMMAEISGFLRQVKSHNACAAGLHLEATPNPVIECFCENNHPEEHE
LKQILCDPRLNVAQTQMLLTHWKERQNDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory