SitesBLAST
Comparing BWI76_RS15205 FitnessBrowser__Koxy:BWI76_RS15205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3efvA Crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2 with bound NAD (see paper)
76% identity, 99% coverage: 3:460/461 of query aligns to 1:458/459 of 3efvA
- active site: N134 (= N136), E231 (= E233), C265 (= C267), E439 (= E441)
- binding nicotinamide-adenine-dinucleotide: I130 (= I132), M131 (= M133), P132 (= P134), W133 (= W135), N134 (= N136), Q139 (= Q141), R142 (= R144), K157 (= K159), A159 (= A161), N190 (= N192), V193 (= V195), T208 (= T210), G209 (= G211), S210 (= S212), A213 (= A215), E231 (= E233), L232 (= L234), G233 (= G235), C265 (= C267), E362 (= E364), F364 (= F366), F428 (= F430)
4itbA Structure of bacterial enzyme in complex with cofactor and substrate (see paper)
43% identity, 97% coverage: 10:457/461 of query aligns to 4:451/453 of 4itbA
- active site: N130 (= N136), K153 (= K159), E227 (= E233), C261 (= C267), E358 (= E364), E435 (= E441)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V126 (≠ I132), M127 (= M133), P128 (= P134), W129 (= W135), N130 (= N136), K153 (= K159), A155 (= A161), S156 (≠ P162), A186 (≠ N192), V189 (= V195), G205 (= G211), S206 (= S212), A209 (= A215), S212 (≠ A218), L228 (= L234), C261 (= C267), E358 (= E364), F360 (= F366)
- binding 4-oxobutanoic acid: E227 (= E233), C261 (= C267), S418 (= S424)
3vz3A Structural insights into substrate and cofactor selection by sp2771 (see paper)
42% identity, 97% coverage: 10:457/461 of query aligns to 4:451/453 of 3vz3A
- active site: N130 (= N136), K153 (= K159), E227 (= E233), A261 (≠ C267), E358 (= E364), E435 (= E441)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V126 (≠ I132), M127 (= M133), W129 (= W135), N130 (= N136), Q135 (= Q141), R138 (= R144), K153 (= K159), A155 (= A161), S156 (≠ P162), A186 (≠ N192), V189 (= V195), T204 (= T210), G205 (= G211), S206 (= S212), A209 (= A215), E227 (= E233), L228 (= L234), G229 (= G235), A261 (≠ C267), F360 (= F366)
- binding 4-oxobutanoic acid: F131 (= F137), W134 (= W140), S260 (≠ V266), A261 (≠ C267), I262 (≠ A268), S418 (= S424)
4ywuA Structural insight into the substrate inhibition mechanism of NADP+- dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes (see paper)
33% identity, 97% coverage: 10:457/461 of query aligns to 4:452/455 of 4ywuA
- active site: N131 (= N136), K154 (= K159), E228 (= E233), C262 (= C267), E359 (= E364), E436 (= E441)
- binding 4-oxobutanoic acid: N131 (= N136), Q136 (= Q141), R139 (= R144), E228 (= E233), V261 (= V266), C262 (= C267), F425 (= F430)
4ohtA Crystal structure of succinic semialdehyde dehydrogenase from streptococcus pyogenes in complex with NADP+ as the cofactor (see paper)
33% identity, 97% coverage: 10:457/461 of query aligns to 4:452/455 of 4ohtA
- active site: N131 (= N136), K154 (= K159), E228 (= E233), C262 (= C267), E359 (= E364), E436 (= E441)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V127 (≠ I132), E128 (≠ M133), P129 (= P134), W130 (= W135), K154 (= K159), H155 (= H160), A156 (= A161), S157 (≠ P162), Y187 (≠ N192), S207 (= S212), I214 (= I219)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 96% coverage: 12:454/461 of query aligns to 32:476/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
35% identity, 96% coverage: 12:454/461 of query aligns to 31:475/481 of 3jz4A
- active site: N156 (= N136), K179 (= K159), E254 (= E233), C288 (= C267), E385 (= E364), E462 (= E441)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P134), W155 (= W135), K179 (= K159), A181 (= A161), S182 (≠ P162), A212 (≠ N192), G216 (vs. gap), G232 (= G211), S233 (= S212), I236 (≠ A215), C288 (= C267), K338 (≠ E317), E385 (= E364), F387 (= F366)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
33% identity, 97% coverage: 10:456/461 of query aligns to 26:479/490 of Q9HTJ1
- GAWN 150:153 (≠ MPWN 133:136) binding
- K162 (≠ G145) active site, Charge relay system
- KPSE 176:179 (≠ KHAP 159:162) binding
- G209 (≠ N192) binding
- GTST 230:233 (≠ SVRA 212:215) binding
- E252 (= E233) active site, Proton acceptor
- C286 (= C267) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E364) binding
- E464 (= E441) active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
33% identity, 97% coverage: 10:456/461 of query aligns to 25:478/489 of 4cazA
- active site: N152 (= N136), K175 (= K159), E251 (= E233), C285 (= C267), E386 (= E364), E463 (= E441)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I132), G149 (≠ M133), W151 (= W135), N152 (= N136), K175 (= K159), E178 (≠ P162), G208 (≠ N192), G212 (≠ S196), F226 (≠ V209), T227 (= T210), G228 (= G211), G229 (≠ S212), T232 (≠ A215), V236 (≠ I219), E251 (= E233), L252 (= L234), C285 (= C267), E386 (= E364), F388 (= F366)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
33% identity, 97% coverage: 10:456/461 of query aligns to 25:478/489 of 2woxA
- active site: N152 (= N136), K175 (= K159), E251 (= E233), C285 (= C267), E386 (= E364), E463 (= E441)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I132), G149 (≠ M133), W151 (= W135), N152 (= N136), K175 (= K159), S177 (≠ A161), E178 (≠ P162), G208 (≠ N192), G212 (≠ S196), F226 (≠ V209), T227 (= T210), G228 (= G211), G229 (≠ S212), T232 (≠ A215), V236 (≠ I219), E251 (= E233), L252 (= L234), C285 (= C267), E386 (= E364), F388 (= F366)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
33% identity, 97% coverage: 10:456/461 of query aligns to 25:478/489 of 2wmeA
- active site: N152 (= N136), K175 (= K159), E251 (= E233), C285 (= C267), E386 (= E364), E463 (= E441)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ M133), W151 (= W135), K175 (= K159), S177 (≠ A161), E178 (≠ P162), G208 (≠ N192), G212 (≠ S196), F226 (≠ V209), G228 (= G211), G229 (≠ S212), T232 (≠ A215), V236 (≠ I219)
5x5uA Crystal structure of alpha-ketoglutarate-semialdehyde dehydrogenase (kgsadh) complexed with NAD (see paper)
36% identity, 97% coverage: 11:456/461 of query aligns to 25:472/476 of 5x5uA
- active site: N151 (= N136), K174 (= K159), E249 (= E233), C283 (= C267), E380 (= E364), E457 (= E441)
- binding nicotinamide-adenine-dinucleotide: P149 (= P134), P207 (≠ N192), A208 (≠ D193), S211 (= S196), G227 (= G211), S228 (= S212), V231 (≠ A215), R329 (≠ D313), R330 (≠ L314), E380 (= E364), F382 (= F366)
Sites not aligning to the query:
5x5tA Crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense (see paper)
36% identity, 97% coverage: 11:456/461 of query aligns to 25:472/476 of 5x5tA
2opxA Crystal structure of lactaldehyde dehydrogenase from escherichia coli
33% identity, 97% coverage: 11:457/461 of query aligns to 25:474/477 of 2opxA
- active site: N151 (= N136), K174 (= K159), E249 (= E233), C283 (= C267), E381 (= E364), A458 (≠ E441)
- binding (3alpha,5beta,12alpha)-3,12-dihydroxycholan-24-oic acid: F105 (≠ K91), F152 (= F137), N284 (≠ A268), F312 (≠ M296), G313 (= G297), R318 (≠ E302), D320 (≠ N304), I321 (≠ Y305), A322 (vs. gap), Y362 (= Y345), F440 (≠ A423), F440 (≠ A423), E441 (≠ S424)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8vqwC
- binding coenzyme a: I147 (= I132), W150 (= W135), K174 (= K159), S176 (≠ A161), E177 (≠ P162), G207 (≠ N192), G211 (≠ S196), F225 (≠ V209), G227 (= G211), G228 (≠ S212), S231 (≠ A215), H331 (≠ L314), F387 (= F366)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
32% identity, 97% coverage: 10:456/461 of query aligns to 24:477/488 of 8uzoA
Query Sequence
>BWI76_RS15205 FitnessBrowser__Koxy:BWI76_RS15205
MNLSATHAVSVNPTTGETLSSLPWASEQQVDSAIALAEQGYRQWRKVSVAQRATTLRNVG
AAMRARSEALAQMISLEMGKPIAQARGEVAKSANLCDWYAEHGPAMLNTEATLVEDNKAV
IEYRPMGAILAIMPWNFPVWQVLRGAVPILLAGNSYLLKHAPNVLGSAAMIGEIFAAAGV
PEGVFGWVNATNDGVSQMINDPRIAAVTVTGSVRAGKAIGAQAGAALKKCVLELGGSDPF
IVLNDADLDEAVKAAVIGRYQNTGQVCAAAKRFIVEAGIAEAFTQKFVAAVAALKMGDPR
DEQNYIGPMARFDLRDELHEQVRATLKEGATLLLGAEKIEGAGNYYAPTVLGNVTAEMTG
FREELFGPVATITEARDADHALALANESEFGLSATVYTTSETQARRFADELECGGVFING
YCASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWRDRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory