Comparing BWI76_RS15245 FitnessBrowser__Koxy:BWI76_RS15245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
37% identity, 78% coverage: 1:228/294 of query aligns to 1:227/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
37% identity, 78% coverage: 1:228/294 of query aligns to 1:227/291 of 3di1B
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
35% identity, 89% coverage: 4:265/294 of query aligns to 1:260/291 of 3pueB
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 97% coverage: 7:291/294 of query aligns to 4:289/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
33% identity, 95% coverage: 7:285/294 of query aligns to 5:284/295 of 1o5kA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 96% coverage: 8:290/294 of query aligns to 15:291/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
33% identity, 96% coverage: 8:290/294 of query aligns to 11:287/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
33% identity, 96% coverage: 8:290/294 of query aligns to 12:288/297 of 5j5dA
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
33% identity, 96% coverage: 8:290/294 of query aligns to 10:286/295 of 3l21B
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
35% identity, 82% coverage: 7:248/294 of query aligns to 4:245/294 of 4i7wA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
33% identity, 94% coverage: 5:281/294 of query aligns to 3:278/295 of 4pfmA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
35% identity, 82% coverage: 7:248/294 of query aligns to 4:245/294 of Q8UGL3
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
35% identity, 88% coverage: 9:268/294 of query aligns to 6:264/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
35% identity, 88% coverage: 9:268/294 of query aligns to 6:264/296 of 7lvlA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
33% identity, 95% coverage: 5:284/294 of query aligns to 2:279/292 of 3s8hA
>BWI76_RS15245 FitnessBrowser__Koxy:BWI76_RS15245
MSNSITGVLTAIVTPFTAEGAVNIPALKQQVQRQLAAGNGIFCGGTNGEFFVLNEAEKVA
VAKACVEEVAGRAPVVAHIGEVSTRETIRLGKQIEQLGVDAVSVITPWFVPLKQDELIAH
YTAIADALSVPVFLYNIPARTGNTIEPQTARALAQHPNIIGVKDSAGSYESLKGFLDAVR
DIADFDVLNGPDSLIHQGFVDGCSACISGLANVAPKEINAIWANFKAGNVEGSRQAQESV
TGLRTDLYKVAFSPAAVKKALQLMGHDVGDSRYAVSFTSAQCEEINHIIAKYIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory