Comparing BWI76_RS15325 FitnessBrowser__Koxy:BWI76_RS15325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 91% coverage: 24:264/265 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 91% coverage: 24:264/265 of query aligns to 4:253/253 of 1g9xB
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 89% coverage: 23:259/265 of query aligns to 3:234/280 of 5x40A
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 92% coverage: 22:265/265 of query aligns to 2:240/501 of P04983
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 86% coverage: 24:252/265 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 92% coverage: 21:264/265 of query aligns to 3:238/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 23:252/265 of query aligns to 1:223/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 83% coverage: 33:252/265 of query aligns to 10:223/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 87% coverage: 23:252/265 of query aligns to 16:235/378 of P69874
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
27% identity, 91% coverage: 24:264/265 of query aligns to 2:235/240 of 6mjpA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 82% coverage: 37:252/265 of query aligns to 18:228/343 of P30750
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 87% coverage: 24:253/265 of query aligns to 4:224/285 of 4yerA
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 82% coverage: 37:252/265 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 82% coverage: 37:252/265 of query aligns to 19:229/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 82% coverage: 37:252/265 of query aligns to 19:229/344 of 6cvlD
Sites not aligning to the query:
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
30% identity, 78% coverage: 42:248/265 of query aligns to 551:746/1704 of Q8R420
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 87% coverage: 34:264/265 of query aligns to 12:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 87% coverage: 34:264/265 of query aligns to 12:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 87% coverage: 34:264/265 of query aligns to 12:235/235 of 6mhzA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 91% coverage: 25:264/265 of query aligns to 7:230/353 of 1vciA
>BWI76_RS15325 FitnessBrowser__Koxy:BWI76_RS15325
MQPDEELFTRQLPTDRFREQTDPVLQLEEINVNFDGFQALTNLSLQIGVGELRCVIGPNG
AGKTTLMDVITGKTRPQSGRALYDQSVDLTTLDPIAIARQGIGRKFQKPTVFEALTVAEN
LELAMKGDKSVWASLRARLNSEQADRISETLRLLRLEGERYRPAGLLSHGQKQFLEIGML
LVQEPHLLLLDEPAAGMTDAETEYTAELFRTLAGQHSLMVVEHDMGFVETIADRVTVLHQ
GQVLAEGSLREVKANEQVIEVYLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory