SitesBLAST
Comparing BWI76_RS15895 FitnessBrowser__Koxy:BWI76_RS15895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8FHC7 D-galactonate dehydratase family member RspA; D-mannonate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.8 from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see paper)
95% identity, 100% coverage: 1:404/404 of query aligns to 12:415/415 of Q8FHC7
- D223 (= D212) binding
- E249 (= E238) binding
- D250 (= D239) binding
- E275 (= E264) binding
4il2B Crystal structure of d-mannonate dehydratase (rspa) from e. Coli cft073 (efi target efi-501585)
95% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of 4il2B
- active site: L36 (= L36), G38 (= G38), W76 (= W76), R147 (= R147), Q149 (= Q149), Y159 (= Y159), D212 (= D212), H214 (= H214), E238 (= E238), G263 (= G263), E264 (= E264), R285 (= R285), T287 (= T287), H314 (= H314), E341 (= E341), W404 (= W404)
- binding magnesium ion: D212 (= D212), E238 (= E238), D239 (= D239), E264 (= E264)
C6D9S0 D-galactonate dehydratase family member PC1_0802; D-mannonate dehydratase; EC 4.2.1.-; EC 4.2.1.8 from Pectobacterium carotovorum subsp. carotovorum (strain PC1) (see paper)
93% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of C6D9S0
- D212 (= D212) binding
- E238 (= E238) binding
- E264 (= E264) binding
4e4fB Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. Carotovorum pc1
88% identity, 100% coverage: 1:404/404 of query aligns to 2:381/381 of 4e4fB
- active site: L37 (= L36), R40 (= R39), R148 (= R147), Q150 (= Q149), D189 (= D212), H191 (= H214), E215 (= E238), G240 (= G263), E241 (= E264), V242 (= V265), R262 (= R285), T264 (= T287), H291 (= H314), P293 (= P316), E318 (= E341), W381 (= W404)
- binding magnesium ion: D189 (= D212), E215 (= E238), E241 (= E264)
B3PDB1 D-galactonate dehydratase family member RspA; D-mannonate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.8 from Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) (see paper)
68% identity, 100% coverage: 1:404/404 of query aligns to 1:402/402 of B3PDB1
- D210 (= D212) binding
- E236 (= E238) binding
- E262 (= E264) binding
3v3wA Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
68% identity, 100% coverage: 1:404/404 of query aligns to 1:397/397 of 3v3wA
- active site: L36 (= L36), R39 (= R39), H122 (= H122), K144 (= K144), R147 (= R147), Q149 (= Q149), Y159 (= Y159), E179 (= E186), D205 (= D212), H207 (= H214), E231 (= E238), G256 (= G263), E257 (= E264), V258 (= V265), R278 (= R285), T280 (= T287), F306 (≠ S313), H307 (= H314), G308 (= G315), A309 (≠ P316), E334 (= E341), W397 (= W404)
- binding magnesium ion: D205 (= D212), E231 (= E238), E257 (= E264)
Q1QT89 D-galactonate dehydratase family member ManD; D-gluconate dehydratase; D-mannonate dehydratase; EC 4.2.1.-; EC 4.2.1.39; EC 4.2.1.8 from Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) (see paper)
67% identity, 100% coverage: 1:404/404 of query aligns to 1:403/403 of Q1QT89
- D211 (= D212) binding
- E237 (= E238) binding
- E263 (= E264) binding
- H313 (= H314) mutation to N: Abolishes activity with D-gluconate and D-mannonate.; mutation to Q: Abolishes activity with D-gluconate. No effect on activity with D-mannonate.
- P315 (= P316) mutation to A: Strongly increases activity with D-mannonate. Slightly decreases activity with D-gluconate.
3thuA Crystal structure of an enolase from sphingomonas sp. Ska58 (efi target efi-501683) with bound mg
67% identity, 100% coverage: 2:404/404 of query aligns to 5:405/405 of 3thuA
- active site: L39 (= L36), E43 (= E40), W79 (= W76), G124 (≠ C121), R150 (= R147), Q152 (= Q149), Y162 (= Y159), D213 (= D212), H215 (= H214), E239 (= E238), G264 (= G263), E265 (= E264), R286 (= R285), T288 (= T287), H315 (= H314), E342 (= E341), W405 (= W404)
- binding magnesium ion: D213 (= D212), E239 (= E238), E265 (= E264)
Q1NAJ2 D-mannonate dehydratase; ManD; EC 4.2.1.8 from Sphingomonas sp. (strain SKA58) (see paper)
67% identity, 100% coverage: 2:404/404 of query aligns to 3:403/403 of Q1NAJ2
- D211 (= D212) binding
- E237 (= E238) binding
- E263 (= E264) binding
B0T0B1 D-mannonate dehydratase Caul1427; ManD; EC 4.2.1.8 from Caulobacter sp. (strain K31) (see paper)
65% identity, 100% coverage: 1:404/404 of query aligns to 2:403/403 of B0T0B1
- D211 (= D212) binding
- E237 (= E238) binding
- E263 (= E264) binding
4fi4A Crystal structure of mannonate dehydratase prk15072 (target efi- 502214) from caulobacter sp. K31
65% identity, 100% coverage: 1:404/404 of query aligns to 6:407/407 of 4fi4A
- active site: L41 (= L36), R44 (= R39), H127 (= H122), R152 (= R147), Q154 (= Q149), Y164 (= Y159), S187 (= S184), D215 (= D212), H217 (= H214), E241 (= E238), G266 (= G263), E267 (= E264), I268 (≠ V265), R288 (= R285), T290 (= T287), C316 (≠ S313), H317 (= H314), G318 (= G315), A319 (≠ P316), E344 (= E341), W407 (= W404)
- binding magnesium ion: D215 (= D212), E241 (= E238), E267 (= E264)
4kwsA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
66% identity, 100% coverage: 1:404/404 of query aligns to 1:397/397 of 4kwsA
- active site: H122 (= H122), R147 (= R147), Q149 (= Q149), Y159 (= Y159), D205 (= D212), H207 (= H214), E231 (= E238), G256 (= G263), E257 (= E264), R278 (= R285), P280 (≠ T287), H307 (= H314), G308 (= G315), E334 (= E341), W397 (= W404)
- binding magnesium ion: D205 (= D212), E231 (= E238), E257 (= E264)
3qkeA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
66% identity, 100% coverage: 1:404/404 of query aligns to 1:397/397 of 3qkeA
- active site: H122 (= H122), R147 (= R147), Q149 (= Q149), Y159 (= Y159), D205 (= D212), H207 (= H214), E231 (= E238), G256 (= G263), E257 (= E264), R278 (= R285), P280 (≠ T287), H307 (= H314), G308 (= G315), E334 (= E341), W397 (= W404)
- binding D-gluconic acid: N37 (= N37), Y159 (= Y159), D205 (= D212), H207 (= H214), E257 (= E264), H307 (= H314), P309 (= P316), D311 (= D318), E334 (= E341), W397 (= W404)
- binding magnesium ion: D205 (= D212), E231 (= E238), E257 (= E264)
4gmeC Crystal structure of mannonate dehydratase (target efi-502209) from caulobacter crescentus cb15 complexed with magnesium and d-mannonate
64% identity, 100% coverage: 1:404/404 of query aligns to 2:403/403 of 4gmeC
- active site: L37 (= L36), R40 (= R39), D211 (= D212), H213 (= H214), E237 (= E238), G262 (= G263), E263 (= E264), I264 (≠ V265), T286 (= T287), H313 (= H314), A315 (≠ P316), E340 (= E341)
- binding d-mannonic acid: N38 (= N37), Y160 (= Y159), D211 (= D212), H213 (= H214), E237 (= E238), E263 (= E264), H313 (= H314), D317 (= D318), E340 (= E341), L390 (= L391), W403 (= W404)
- binding magnesium ion: D211 (= D212), E237 (= E238), E263 (= E264)
4gmeA Crystal structure of mannonate dehydratase (target efi-502209) from caulobacter crescentus cb15 complexed with magnesium and d-mannonate
64% identity, 100% coverage: 1:404/404 of query aligns to 2:403/403 of 4gmeA
- active site: L37 (= L36), R40 (= R39), T119 (≠ M118), R148 (= R147), Q150 (= Q149), Y160 (= Y159), D211 (= D212), H213 (= H214), E237 (= E238), G262 (= G263), E263 (= E264), I264 (≠ V265), R284 (= R285), T286 (= T287), H313 (= H314), A315 (≠ P316), E340 (= E341), W403 (= W404)
- binding carbonate ion: R148 (= R147), Y160 (= Y159), D211 (= D212), E263 (= E264), E340 (= E341)
- binding magnesium ion: D211 (= D212), E237 (= E238), E263 (= E264)
Q9AAR4 D-mannonate dehydratase CC0532; ManD; EC 4.2.1.8 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
64% identity, 100% coverage: 1:404/404 of query aligns to 2:403/403 of Q9AAR4
- D211 (= D212) binding
- E237 (= E238) binding
- E263 (= E264) binding
3p93C Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d- gluconate
64% identity, 100% coverage: 1:404/404 of query aligns to 1:384/384 of 3p93C
- active site: H122 (= H122), R147 (= R147), Q149 (= Q149), D192 (= D212), H194 (= H214), E218 (= E238), G243 (= G263), E244 (= E264), R265 (= R285), P267 (≠ T287), H294 (= H314), G295 (= G315), E321 (= E341), W384 (= W404)
- binding 2-keto-3-deoxygluconate: N37 (= N37), D192 (= D212), H194 (= H214), E244 (= E264), H294 (= H314), P296 (= P316), D298 (= D318), E321 (= E341), W384 (= W404)
- binding magnesium ion: D192 (= D212), E218 (= E238), E244 (= E264)
3p93A Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d- gluconate
64% identity, 100% coverage: 1:404/404 of query aligns to 1:384/384 of 3p93A
- active site: H122 (= H122), R147 (= R147), Q149 (= Q149), D192 (= D212), H194 (= H214), E218 (= E238), G243 (= G263), E244 (= E264), R265 (= R285), P267 (≠ T287), H294 (= H314), G295 (= G315), E321 (= E341), W384 (= W404)
- binding d-mannonic acid: N37 (= N37), D192 (= D212), H194 (= H214), E244 (= E264), H294 (= H314), P296 (= P316), D298 (= D318), E321 (= E341)
- binding magnesium ion: D192 (= D212), E218 (= E238), E244 (= E264)
3rgtA Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
64% identity, 100% coverage: 1:404/404 of query aligns to 1:383/383 of 3rgtA
- active site: H122 (= H122), R147 (= R147), Q149 (= Q149), D191 (= D212), H193 (= H214), E217 (= E238), G242 (= G263), E243 (= E264), R264 (= R285), P266 (≠ T287), H293 (= H314), G294 (= G315), E320 (= E341), W383 (= W404)
- binding cobalt (ii) ion: D191 (= D212), E217 (= E238), E243 (= E264)
- binding (2S,3R,4R)-2,3,4,5-tetrahydroxy-N-oxo-pentanamide: N37 (= N37), D191 (= D212), H193 (= H214), E243 (= E264), H293 (= H314), P295 (= P316), D297 (= D318), E320 (= E341), W383 (= W404)
2qjjA Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans (see paper)
65% identity, 100% coverage: 1:404/404 of query aligns to 1:402/402 of 2qjjA
- active site: G121 (≠ C121), R147 (= R147), Q149 (= Q149), Y159 (= Y159), D210 (= D212), H212 (= H214), E236 (= E238), G261 (= G263), E262 (= E264), R283 (= R285), T285 (= T287), H312 (= H314), E339 (= E341), W402 (= W404)
- binding magnesium ion: D210 (= D212), E236 (= E238), E262 (= E264)
Query Sequence
>BWI76_RS15895 FitnessBrowser__Koxy:BWI76_RS15895
MKIVAAEVFVTCPGRNFVTLKVTTDDGIVGLGDATLNGRELSVASYLRDHLCPQLIGRDA
HRIEDIWQFFYKGAYWRRGPVTMSAISAIDMALWDIKAKAAGMPLYQLLGGASREGVMVY
CHTTGHSIDEVLDDYARHKEMGFKAIRVQCGVPGMKTTYGMAKGKGQAYEPATKGQWPEE
QLWSTEKYLDFTPQLFAAVREKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRLFWMEDP
TPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFD
NGYMHPGEKPGLGIEFDEKLAAKYPYEPAYLPVARLEDGTLWNW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory