Comparing BWI76_RS16300 FitnessBrowser__Koxy:BWI76_RS16300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bobA Structural basis for negative regulation of the maltose system (see paper)
72% identity, 99% coverage: 1:387/392 of query aligns to 1:387/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
72% identity, 99% coverage: 1:387/392 of query aligns to 1:387/390 of P23256
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
34% identity, 98% coverage: 2:386/392 of query aligns to 1:386/387 of 6qp3A
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
31% identity, 98% coverage: 2:387/392 of query aligns to 3:388/388 of 4dq6A
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
30% identity, 99% coverage: 2:388/392 of query aligns to 3:387/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
30% identity, 99% coverage: 2:388/392 of query aligns to 3:387/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
30% identity, 99% coverage: 2:388/392 of query aligns to 3:387/387 of 3b1cA
3l8aB Crystal structure of metc from streptococcus mutans
29% identity, 98% coverage: 2:386/392 of query aligns to 2:383/385 of 3l8aB
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
28% identity, 99% coverage: 1:387/392 of query aligns to 2:391/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
28% identity, 99% coverage: 1:387/392 of query aligns to 2:391/394 of 1c7nA
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
28% identity, 99% coverage: 1:389/392 of query aligns to 1:397/397 of 7qugA
5z0qC Crystal structure of ovob (see paper)
34% identity, 98% coverage: 2:386/392 of query aligns to 1:375/379 of 5z0qC
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
29% identity, 98% coverage: 2:386/392 of query aligns to 8:397/398 of 6qp1B
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
28% identity, 98% coverage: 2:386/392 of query aligns to 1:378/383 of 6qp2A
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
26% identity, 94% coverage: 21:387/392 of query aligns to 10:376/380 of 2x5dD
1j32A Aspartate aminotransferase from phormidium lapideum
22% identity, 90% coverage: 29:382/392 of query aligns to 31:380/388 of 1j32A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
25% identity, 93% coverage: 24:389/392 of query aligns to 27:385/385 of Q56232
Sites not aligning to the query:
4wljA High resolution crystal structure of human kynurenine aminotransferase-i in complex with aminooxyacetate (see paper)
25% identity, 63% coverage: 111:356/392 of query aligns to 112:375/413 of 4wljA
Sites not aligning to the query:
1w7nA Crystal structure of human kynurenine aminotransferase i in pmp form (see paper)
26% identity, 63% coverage: 111:356/392 of query aligns to 112:378/415 of 1w7nA
Sites not aligning to the query:
1w7mA Crystal structure of human kynurenine aminotransferase i in complex with l-phe (see paper)
26% identity, 63% coverage: 111:356/392 of query aligns to 112:378/415 of 1w7mA
Sites not aligning to the query:
>BWI76_RS16300 FitnessBrowser__Koxy:BWI76_RS16300
MFDFSTPVDRHGTWCTQWDYVADRFGAADLLPFTISDMDFATAPCILDAVSKRLAHGVFG
YSRWKNDEFLGAVSHWFASRFHSSIDREALVYGPSVIYMVAEMIRQWSAVGDGIVVHAPA
YDAFYKTIEGNQRRVAPVPLTLDSGQWRCDMAQLEQALAEPRNTVLLLCSPHNPTGKVWT
REELETMARLCEKHGVKAISDEIHMDMAWDGHQHIPWCEVARSPWALFTSGSKSFNIPAF
TGAYGLIDDAAARESYLHALKSRDGLSSPSVPALVAHIAAYREGAAWLDALRGYLQENMR
YIADELNQAFPELNWQPPQATYLAWIDLRPLAIDDRALQKALIEEQKIAIMPGDTYGEAG
KGFVRLNAGCPREKLEKGVQGLIAALRRSPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory