SitesBLAST
Comparing BWI76_RS16340 FitnessBrowser__Koxy:BWI76_RS16340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yifA Pyruvylated beta-d-galactosidase from bacillus sp. Hma207, e163a mutant pyruvylated beta-d-galactose complex (see paper)
52% identity, 99% coverage: 4:455/456 of query aligns to 3:458/459 of 5yifA
- binding (2R,4aR,6R,7R,8R,8aR)-2-methyl-6,7,8-tris(oxidanyl)-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxine-2-carboxylic acid: Q17 (= Q18), H118 (= H119), N162 (= N163), N295 (= N293), Y297 (= Y295), W337 (= W334), E364 (= E361), W410 (= W407), S417 (= S414), W418 (= W415), K424 (= K421)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
49% identity, 99% coverage: 4:453/456 of query aligns to 3:422/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (≠ T165), N165 (≠ I166), L194 (≠ V195), L195 (≠ F196), L218 (≠ N219), L220 (= L221), N244 (≠ H244), F247 (≠ L248), K253 (= K254), Y256 (= Y257), L288 (≠ C287), R318 (≠ M347), Y323 (= Y352)
- binding magnesium ion: H346 (≠ V376), K409 (= K440)
4zfmC Structure of gan1d-e170q in complex with cellobiose-6-phosphate
48% identity, 100% coverage: 1:455/456 of query aligns to 2:460/461 of 4zfmC
- active site: R76 (= R75), H120 (= H119), Q166 (≠ E164), I169 (≠ V167), N295 (= N293), Y297 (= Y295), E361 (= E361)
- binding 1,5-anhydro-6-O-phosphono-D-glucitol: Q19 (= Q18), H120 (= H119), Q166 (≠ E164), E361 (= E361), W408 (= W407), S415 (= S414), W416 (= W415), Y424 (= Y423)
- binding beta-D-glucopyranose: Q166 (≠ E164), Y297 (= Y295)
5okbB High resolution structure of native gan1d, a putative 6-phospho-beta- galactosidase from geobacillus stearothermophilus (see paper)
47% identity, 100% coverage: 1:455/456 of query aligns to 2:473/474 of 5okbB
4zepA Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
47% identity, 100% coverage: 1:455/456 of query aligns to 2:473/474 of 4zepA
- active site: R76 (= R75), H120 (= H119), E166 (= E164), I169 (≠ V167), N295 (= N293), Y297 (= Y295), E374 (= E361)
- binding 6-O-phosphono-beta-D-glucopyranose: Q19 (= Q18), E166 (= E164), Y297 (= Y295), W348 (= W334), E374 (= E361), W421 (= W407), S428 (= S414), K435 (= K421), Y437 (= Y423)
8b80A The structure of gan1d w433a in complex with galactose-6p
47% identity, 100% coverage: 1:455/456 of query aligns to 2:473/474 of 8b80A
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
47% identity, 98% coverage: 4:449/456 of query aligns to 3:440/445 of 4ptwA
- active site: R74 (= R75), H118 (= H119), E163 (= E164), V166 (= V167), N291 (= N293), Y293 (= Y295), E351 (= E361)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q18), H118 (= H119), E163 (= E164), Y293 (= Y295), E351 (= E361), W398 (= W407), E405 (≠ S414), W406 (= W415)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
47% identity, 98% coverage: 4:449/456 of query aligns to 3:440/445 of 4ptvA
- active site: R74 (= R75), H118 (= H119), E163 (= E164), V166 (= V167), N291 (= N293), Y293 (= Y295), E351 (= E361)
- binding beta-D-glucopyranose: W324 (= W334), E405 (≠ S414), Y408 (≠ N417)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q18), H118 (= H119), E163 (= E164), Y293 (= Y295), E351 (= E361), W398 (= W407), E405 (≠ S414), W406 (= W415)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
42% identity, 99% coverage: 4:453/456 of query aligns to 6:447/451 of 8ivyA
6jfpA Crystal structure of the beta-glucosidase bgl15 (see paper)
43% identity, 99% coverage: 4:453/456 of query aligns to 3:441/444 of 6jfpA
5gnxA The e171q mutant structure of bgl6 (see paper)
43% identity, 99% coverage: 4:454/456 of query aligns to 7:447/451 of 5gnxA
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
39% identity, 98% coverage: 4:451/456 of query aligns to 5:440/447 of 1e4iA
- active site: R76 (= R75), H120 (= H119), E165 (= E164), C168 (≠ T165), N293 (= N293), Y295 (= Y295), E351 (= E361)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q18), H120 (= H119), N164 (= N163), E165 (= E164), Y295 (= Y295), E351 (= E361), W397 (= W407), E404 (≠ S414), W405 (= W415)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R135), Q140 (= Q139), V143 (≠ A142), L202 (= L201)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
39% identity, 98% coverage: 4:451/456 of query aligns to 5:440/447 of 1bggB
- active site: R76 (= R75), H120 (= H119), E165 (= E164), C168 (≠ T165), N293 (= N293), Y295 (= Y295), E351 (= E361)
- binding D-gluconic acid: Q19 (= Q18), H120 (= H119), W121 (= W120), N164 (= N163), E165 (= E164), Y295 (= Y295), E351 (= E361), W397 (= W407), E404 (≠ S414), W405 (= W415)
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
39% identity, 98% coverage: 4:451/456 of query aligns to 6:441/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H119), E166 (= E164), L173 (≠ I169), E352 (= E361), W398 (= W407), E405 (≠ S414), W406 (= W415)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
39% identity, 98% coverage: 4:451/456 of query aligns to 6:441/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H119), W122 (= W120), E166 (= E164), L173 (≠ I169), W326 (= W334), E352 (= E361), W398 (= W407), E405 (≠ S414), W406 (= W415)
1gnxA B-glucosidase from streptomyces sp
44% identity, 98% coverage: 4:448/456 of query aligns to 4:440/447 of 1gnxA
- active site: R75 (= R75), H119 (= H119), E164 (= E164), C167 (≠ V167), N293 (= N293), Y295 (= Y295), E353 (= E361)
- binding beta-D-fructofuranose: Q285 (≠ N285), K286 (≠ R286)
- binding alpha-D-glucopyranose: Q204 (≠ K204), R281 (≠ L281), Q285 (≠ N285)
- binding sulfate ion: R190 (≠ Q190), F274 (= F274), R276 (≠ P276)
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
41% identity, 99% coverage: 1:453/456 of query aligns to 2:440/442 of 1oinA
- active site: R76 (= R75), H120 (= H119), E165 (= E164), V168 (= V167), N292 (= N293), Y294 (= Y295), E348 (= E361)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q18), H120 (= H119), N164 (= N163), E165 (= E164), Y294 (= Y295), E348 (= E361), W395 (= W407), E402 (≠ S414), W403 (= W415)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
41% identity, 99% coverage: 1:453/456 of query aligns to 1:438/440 of 2cesA
- active site: R75 (= R75), H119 (= H119), E164 (= E164), V167 (= V167), N291 (= N293), Y293 (= Y295), E346 (= E361)
- binding glucoimidazole: Q18 (= Q18), H119 (= H119), N163 (= N163), E164 (= E164), Y293 (= Y295), E346 (= E361), W393 (= W407), E400 (≠ S414), W401 (= W415), F409 (≠ Y423)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
41% identity, 99% coverage: 1:453/456 of query aligns to 2:440/442 of 2wc3A
- active site: R76 (= R75), H120 (= H119), E165 (= E164), V168 (= V167), N292 (= N293), Y294 (= Y295), E348 (= E361)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q18), H120 (= H119), N164 (= N163), E165 (= E164), Y294 (= Y295), H297 (≠ E298), W321 (= W334), E348 (= E361), W395 (= W407), E402 (≠ S414), W403 (= W415), F411 (≠ Y423)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
41% identity, 99% coverage: 1:453/456 of query aligns to 1:440/443 of 2j78A
- active site: R75 (= R75), H119 (= H119), E164 (= E164), V167 (= V167), N291 (= N293), Y293 (= Y295), E348 (= E361)
- binding calcium ion: E64 (≠ A64), E67 (≠ A67), D276 (≠ G277), S279 (≠ A280)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q18), H119 (= H119), N163 (= N163), E164 (= E164), Y293 (= Y295), E348 (= E361), W395 (= W407), E402 (≠ S414), W403 (= W415), F411 (≠ Y423)
Query Sequence
>BWI76_RS16340 FitnessBrowser__Koxy:BWI76_RS16340
MSGFPQHFLWGAATAAWQVEGGHDADGKGPSIWDTYSHLPGTTYQGTTGDIAVDHYHRFR
EDVALMAEMGLQSYRFSISWPRLLPTGRGEVNEAGVQFYSDLIDELLAHNIEPMITLYHW
DLPQALQDEGGWEARSTAQAFAEYARLCYQRFGSRVKLWATFNETIVFIGHGYINGIHPP
AVRDPARAIQACHHVFIAHALAVKAFREMGVAGEIGFVNVLQPHTALTDSEADKQATEMA
DAIHTHWLYDPVLKGGYPAELLQKTQALWGVPAFEPGDDALLRDNRCDFIGLNYYRRETV
SAQPPEVATGGEPGVDGLFYFVRNPQSTYTEWGWEIWPQGLTDGIMMIKARYGDIPIYIT
ENGLGAVDPIINGEIVDDPRIDYLSSHITALEKALELGADVRGYYPWSFIDLLSWLNGYK
KQYGFVYVDHQQNLARKRKKSFFWYQNVIASRGEQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory