SitesBLAST
Comparing BWI76_RS16625 FitnessBrowser__Koxy:BWI76_RS16625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
69% identity, 96% coverage: 11:293/294 of query aligns to 9:291/292 of 5jydB
- active site: G58 (= G60), S184 (= S186), L194 (= L196), Y197 (= Y199), K201 (= K203), P242 (≠ D244)
- binding magnesium ion: D56 (= D58), S57 (= S59), E82 (= E84)
- binding nicotinamide-adenine-dinucleotide: G54 (= G56), D56 (= D58), S57 (= S59), G58 (= G60), I59 (= I61), L79 (= L81), E82 (= E84), D106 (= D108), I107 (≠ V109), N133 (= N135), A134 (= A136), A135 (≠ G137), T182 (= T184), S184 (= S186), Y197 (= Y199), K201 (= K203), P227 (= P229), G228 (= G230), P229 (= P231), Y230 (= Y232), T232 (= T234), L234 (= L236), Q235 (= Q237)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
56% identity, 97% coverage: 8:291/294 of query aligns to 11:289/292 of 3r3sA
- active site: G58 (= G60), S184 (= S186), L194 (= L196), Y197 (= Y199), K201 (= K203), Q242 (≠ D244)
- binding magnesium ion: D56 (= D58), S57 (= S59), E82 (= E84)
- binding nicotinamide-adenine-dinucleotide: D56 (= D58), S57 (= S59), G58 (= G60), I59 (= I61), L79 (= L81), E82 (= E84), D106 (= D108), L107 (≠ V109), V133 (≠ N135), A134 (= A136), G135 (= G137), S184 (= S186), Y197 (= Y199), K201 (= K203), P227 (= P229), G228 (= G230), I230 (≠ Y232), T232 (= T234), L234 (= L236), Q235 (= Q237)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
53% identity, 99% coverage: 1:291/294 of query aligns to 1:291/294 of P0AG84
- K39 (≠ L39) modified: N6-acetyllysine
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
49% identity, 91% coverage: 24:290/294 of query aligns to 21:285/290 of 3ijrF
- active site: G57 (= G60), S182 (= S186), L192 (= L196), Y195 (= Y199), K199 (= K203), K240 (≠ E245)
- binding magnesium ion: D55 (= D58), S56 (= S59), E80 (= E84)
- binding nicotinamide-adenine-dinucleotide: P21 (= P24), D55 (= D58), S56 (= S59), G57 (= G60), I58 (= I61), Y77 (= Y80), L78 (= L81), E80 (= E84), G103 (= G107), D104 (= D108), L105 (≠ V109), N131 (= N135), V132 (≠ A136), A133 (≠ G137), Q134 (≠ R138), I155 (≠ T159), T180 (= T184), S182 (= S186), Y195 (= Y199), K199 (= K203), P225 (= P229), G226 (= G230), P227 (= P231), I228 (≠ Y232), T230 (= T234), L232 (= L236)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
48% identity, 94% coverage: 16:290/294 of query aligns to 1:277/282 of 3i3oA
- active site: G49 (= G60), S174 (= S186), L184 (= L196), Y187 (= Y199), K191 (= K203), K232 (≠ E245)
- binding magnesium ion: D47 (= D58), S48 (= S59), E72 (= E84)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G56), D47 (= D58), S48 (= S59), G49 (= G60), I50 (= I61), Y69 (= Y80), L70 (= L81), E72 (= E84), G95 (= G107), D96 (= D108), L97 (≠ V109), N123 (= N135), V124 (≠ A136), A125 (≠ G137), Q126 (≠ R138), Q127 (= Q139), I147 (≠ T159), T172 (= T184), S174 (= S186), Y187 (= Y199), K191 (= K203), P217 (= P229), G218 (= G230), I220 (≠ Y232), T222 (= T234), L224 (= L236)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 83% coverage: 46:290/294 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G56), S20 (≠ D58), K21 (≠ S59), G22 (= G60), I23 (= I61), A43 (≠ L81), S44 (≠ P82), S45 (≠ E83), G68 (= G107), D69 (= D108), V70 (= V109), N96 (= N135), S97 (≠ A136), G98 (= G137), Y100 (≠ Q139), I144 (≠ T184), S146 (= S186), Y159 (= Y199), K163 (= K203), P189 (= P229), G190 (= G230), M191 (≠ P231), I192 (≠ Y232), T194 (= T234), G196 (≠ L236), T197 (≠ Q237)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S186), Y159 (= Y199), M191 (≠ P231), I202 (≠ Q242)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
36% identity, 83% coverage: 47:290/294 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 53:77, 48% identical) binding
- E96 (≠ Q139) mutation E->A,G,K: Heat stable.
- D108 (= D152) mutation to N: Heat stable.
- V112 (≠ T156) mutation to A: Heat stable.
- E133 (= E177) mutation to K: Heat stable.
- V183 (= V224) mutation to I: Heat stable.
- P194 (≠ V235) mutation to Q: Heat stable.
- E210 (≠ G251) mutation to K: Heat stable.
- Y217 (≠ R258) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
36% identity, 83% coverage: 47:290/294 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G60), S145 (= S186), Y158 (= Y199), K162 (= K203)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S59), G18 (= G60), L19 (≠ I61), R39 (≠ L81), D65 (= D108), V66 (= V109), N92 (= N135), A93 (= A136), G94 (= G137), M143 (≠ T184), S145 (= S186), Y158 (= Y199), P188 (= P229), G189 (= G230), I191 (≠ Y232), T193 (= T234)
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
36% identity, 82% coverage: 50:290/294 of query aligns to 3:254/258 of Q9ZNN8
- QGI 12:14 (≠ SGI 59:61) binding
- D33 (≠ Y80) binding
- Q37 (≠ E84) binding
- DV 61:62 (= DV 108:109) binding
- N88 (= N135) binding
- I142 (≠ T184) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (= F190) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y199) binding
- K158 (= K203) binding
- PGIVGT 184:189 (≠ PGPYWT 229:234) binding
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
36% identity, 82% coverage: 50:290/294 of query aligns to 2:253/257 of 3a28C
- active site: G12 (= G60), S140 (≠ N183), Y153 (= Y199), K157 (= K203), L198 (= L236)
- binding nicotinamide-adenine-dinucleotide: G8 (= G56), Q11 (≠ S59), I13 (= I61), D32 (≠ Y80), L33 (= L81), Q36 (≠ E84), L59 (≠ G107), D60 (= D108), V61 (= V109), N87 (= N135), S140 (≠ N183), Y153 (= Y199), K157 (= K203), P183 (= P229), V186 (≠ Y232), T188 (= T234), M190 (vs. gap), W191 (vs. gap)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 83% coverage: 47:290/294 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G60), S151 (= S186), Y164 (= Y199), K168 (= K203)
- binding beta-D-glucopyranose: E102 (≠ Q139), S151 (= S186), H153 (≠ Q188), W158 (≠ S193), Y164 (= Y199), N202 (≠ Q237), K205 (≠ G240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G56), T23 (≠ S59), G24 (= G60), L25 (≠ I61), Y45 (≠ L81), D71 (= D108), V72 (= V109), N98 (= N135), A99 (= A136), G100 (= G137), V101 (≠ R138), M149 (≠ T184), S151 (= S186), Y164 (= Y199), K168 (= K203), P194 (= P229), G195 (= G230), M197 (≠ Y232), T199 (= T234), P200 (≠ V235), I201 (≠ L236), N202 (≠ Q237)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 82% coverage: 50:290/294 of query aligns to 5:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 82% coverage: 50:290/294 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G60), S138 (= S186), Q148 (≠ L196), Y151 (= Y199), K155 (= K203)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G56), S10 (≠ D58), R11 (≠ S59), I13 (= I61), N31 (= N79), Y32 (= Y80), A33 (≠ L81), G34 (≠ P82), S35 (≠ E83), A58 (≠ G107), N59 (≠ D108), V60 (= V109), N86 (= N135), A87 (= A136), T109 (= T159), S138 (= S186), Y151 (= Y199), K155 (= K203), P181 (= P229), G182 (= G230)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
36% identity, 81% coverage: 53:290/294 of query aligns to 8:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G56), S13 (≠ D58), R14 (≠ S59), G15 (= G60), I16 (= I61), L36 (= L81), R37 (≠ P82), N38 (≠ E83), A61 (≠ G107), D62 (= D108), V63 (= V109), N89 (= N135), A90 (= A136), G91 (= G137), T113 (= T159), V143 (≠ T184), S145 (= S186), Y159 (= Y199), K163 (= K203), P189 (= P229), G190 (= G230), I192 (≠ Y232), T194 (= T234), I196 (≠ L236), H197 (≠ Q237)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
45% identity, 70% coverage: 46:251/294 of query aligns to 3:213/246 of 5u2wA
- active site: G17 (= G60), S141 (= S186), M152 (≠ L196), Y155 (= Y199), K159 (= K203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G56), S15 (≠ D58), R16 (≠ S59), G17 (= G60), I18 (= I61), Y37 (= Y80), E38 (≠ L81), K39 (≠ P82), S40 (≠ E83), A63 (≠ G107), D64 (= D108), S65 (≠ V109), N91 (= N135), A92 (= A136), G93 (= G137), T139 (= T184), Y155 (= Y199), K159 (= K203), P185 (= P229), G186 (= G230), T188 (≠ Y232), T190 (= T234), M192 (≠ L236), N193 (≠ Q237)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 83% coverage: 46:290/294 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G60), N111 (= N160), S139 (= S186), Q149 (≠ L196), Y152 (= Y199), K156 (= K203)
- binding acetoacetyl-coenzyme a: D93 (≠ Y141), K98 (≠ E147), S139 (= S186), N146 (≠ S193), V147 (≠ P194), Q149 (≠ L196), Y152 (= Y199), F184 (≠ P231), M189 (≠ L236), K200 (≠ Q249)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G56), N17 (≠ S59), G18 (= G60), I19 (= I61), D38 (= D87), F39 (≠ A88), V59 (vs. gap), D60 (= D108), V61 (= V109), N87 (= N135), A88 (= A136), G89 (= G137), I90 (≠ R138), T137 (= T184), S139 (= S186), Y152 (= Y199), K156 (= K203), P182 (= P229), F184 (≠ P231), T185 (≠ Y232), T187 (= T234), M189 (≠ L236)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
36% identity, 83% coverage: 47:290/294 of query aligns to 3:242/245 of 5wuwA
- active site: G16 (= G60), S140 (= S186), Y154 (= Y199), L161 (= L206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G56), R15 (≠ S59), I17 (= I61), Y36 (= Y80), A37 (≠ L81), A38 (≠ P82), D63 (= D108), S64 (≠ V109), N90 (= N135), A91 (= A136), G92 (= G137), Y154 (= Y199), K158 (= K203), G185 (= G230), P186 (= P231), V187 (≠ Y232)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 83% coverage: 47:290/294 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G60), S142 (= S186), Q152 (≠ L196), Y155 (= Y199), K159 (= K203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G56), S14 (≠ D58), R15 (≠ S59), G16 (= G60), I17 (= I61), N35 (= N79), Y36 (= Y80), N37 (≠ L81), G38 (≠ P82), S39 (≠ E83), N63 (≠ D108), V64 (= V109), N90 (= N135), A91 (= A136), I93 (vs. gap), I113 (≠ T159), S142 (= S186), Y155 (= Y199), K159 (= K203), P185 (= P229), I188 (≠ Y232), T190 (= T234)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
36% identity, 82% coverage: 50:290/294 of query aligns to 3:247/248 of 4iqgD
- active site: G13 (= G60), N112 (= N160), S143 (= S186), Y154 (≠ L196), Y157 (= Y199), K161 (= K203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G56), S11 (≠ D58), R12 (≠ S59), G13 (= G60), I14 (= I61), N32 (= N79), A34 (≠ P82), S35 (≠ E83), N36 (≠ E84), A59 (≠ G107), D60 (= D108), V61 (= V109), N87 (= N135), A88 (= A136), G89 (= G137), V141 (≠ T184), S143 (= S186), Y157 (= Y199), K161 (= K203), P187 (= P229), G188 (= G230), I190 (≠ Y232), T192 (= T234), I194 (≠ L236), H195 (≠ Q237)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
35% identity, 84% coverage: 45:290/294 of query aligns to 5:259/261 of 4fj0D
- active site: G20 (= G60), S144 (= S186), N145 (≠ V187), H155 (≠ L196), Y158 (= Y199), K162 (= K203), Y203 (≠ V235)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S186), N145 (≠ V187), G190 (≠ P231), F196 (vs. gap), S200 (vs. gap), Y203 (≠ V235), A219 (≠ G251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G56), R19 (≠ S59), G20 (= G60), I21 (= I61), A41 (≠ P82), N42 (≠ E83), S43 (≠ E84), I68 (≠ V109), N94 (= N135), S95 (≠ A136), G96 (= G137), L117 (≠ T159), T142 (= T184), Y158 (= Y199), K162 (= K203), P188 (= P229), G189 (= G230), G190 (≠ P231), T191 (≠ Y232), T193 (= T234), M195 (vs. gap)
Query Sequence
>BWI76_RS16625 FitnessBrowser__Koxy:BWI76_RS16625
MSDYANNTAKYPRPPFVDQPQSPPGLAEEMKPQPDHGELSYVGSGRLAGKRALITGGDSG
IGRAVAIAFAREGADVAINYLPEEESDAQTVIALIEAEGRQAVAIPGDVRDESFCETLVE
QAASELGGLDILVNNAGRQQYCESLEELTTADFDATFKTNVYAAFWITKAALRHLKEHSA
IINTSSVQAFKPSPILLDYAQTKACLVAFTKSLAKQLGPKGIRVNAVAPGPYWTVLQSSG
GQPDEKVRQFGADTPLGRPGQPVEIAPLYVTLASDACSFTSGQVWCSDGGDGVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory