Comparing BWI76_RS16675 FitnessBrowser__Koxy:BWI76_RS16675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 86% coverage: 11:309/348 of query aligns to 2:310/343 of P30750
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
48% identity, 79% coverage: 11:286/348 of query aligns to 3:288/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
45% identity, 86% coverage: 11:309/348 of query aligns to 3:311/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
45% identity, 86% coverage: 11:309/348 of query aligns to 3:311/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
43% identity, 66% coverage: 24:252/348 of query aligns to 15:241/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 68% coverage: 16:250/348 of query aligns to 4:239/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
41% identity, 69% coverage: 11:250/348 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
41% identity, 69% coverage: 11:250/348 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
41% identity, 69% coverage: 11:250/348 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
41% identity, 69% coverage: 11:250/348 of query aligns to 4:241/242 of 2oljA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 76% coverage: 29:294/348 of query aligns to 44:305/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 76% coverage: 29:294/348 of query aligns to 44:305/382 of 7aheC
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
39% identity, 63% coverage: 11:230/348 of query aligns to 2:220/222 of 8i6rB
7ahdC Opua (e190q) occluded (see paper)
38% identity, 62% coverage: 29:244/348 of query aligns to 44:260/260 of 7ahdC
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
38% identity, 62% coverage: 11:226/348 of query aligns to 4:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
38% identity, 62% coverage: 11:226/348 of query aligns to 4:218/230 of 6z4wA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 62% coverage: 11:225/348 of query aligns to 4:220/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 65% coverage: 11:235/348 of query aligns to 2:232/232 of 1f3oA
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 63% coverage: 11:228/348 of query aligns to 4:224/248 of 8g4cB
8hprD Lpqy-sugabc in state 4 (see paper)
35% identity, 69% coverage: 10:249/348 of query aligns to 2:236/362 of 8hprD
>BWI76_RS16675 FitnessBrowser__Koxy:BWI76_RS16675
MTQKPNPTTHIQLSQISKAYPNGVQALRDINLQIAQGEIFGIIGRSGAGKSTLLRLFNRL
ENADSGEITIHGEHTRHYSRSQLRDLRRRVAMIFQHFNLMATKTVAQNVELPLKMAGVPR
AERQKRVDEILALVGLSALRDSWPAKLSGGQKQRTGIARALVTQPEILLCDEATSALDPE
NTHAVLKLLKEINQRLGLTIVLITHEMDVIRTLCDRVAVLEHGEIIEQGEVWRVFGHPGH
AVTRSLLGTLHHDRAEERLSLSENQQLVTLHFDGSSGQEPDLQRIAALLGADARLLYGSC
EQIQGRVIGQLRIRLAKPLANPHLQQHAGWVADRLTLSGDTAAENAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory