Comparing BWI76_RS16730 FitnessBrowser__Koxy:BWI76_RS16730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
50% identity, 95% coverage: 8:383/395 of query aligns to 4:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
50% identity, 95% coverage: 8:383/395 of query aligns to 4:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
50% identity, 95% coverage: 8:383/395 of query aligns to 4:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
50% identity, 95% coverage: 8:383/395 of query aligns to 4:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
50% identity, 95% coverage: 8:383/395 of query aligns to 4:380/381 of 4ixzA
4ixsB Native structure of xometc at ph 5.2 (see paper)
49% identity, 95% coverage: 8:383/395 of query aligns to 3:371/372 of 4ixsB
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
48% identity, 96% coverage: 4:383/395 of query aligns to 1:381/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
48% identity, 96% coverage: 4:383/395 of query aligns to 1:381/382 of 6k1lA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
46% identity, 96% coverage: 8:386/395 of query aligns to 7:374/377 of 7ba4A
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
46% identity, 95% coverage: 10:383/395 of query aligns to 6:380/381 of 6cjaA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
44% identity, 98% coverage: 1:386/395 of query aligns to 1:373/373 of 4l0oH
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
42% identity, 96% coverage: 8:385/395 of query aligns to 9:387/390 of 8j6nA
3qhxA Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
43% identity, 95% coverage: 8:383/395 of query aligns to 3:376/377 of 3qhxA
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
41% identity, 96% coverage: 5:383/395 of query aligns to 5:381/385 of 5x5hA
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 5:387/395 of query aligns to 2:384/386 of P00935
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
39% identity, 97% coverage: 1:384/395 of query aligns to 1:377/377 of 7d7oB
6ldoA Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
42% identity, 95% coverage: 10:386/395 of query aligns to 5:378/381 of 6ldoA
6le4A Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with cystathionine (see paper)
42% identity, 95% coverage: 10:386/395 of query aligns to 5:378/380 of 6le4A
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
41% identity, 96% coverage: 9:387/395 of query aligns to 4:382/384 of 1cs1D
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
40% identity, 96% coverage: 4:383/395 of query aligns to 3:391/395 of 5m3zA
>BWI76_RS16730 FitnessBrowser__Koxy:BWI76_RS16730
MKTRTKDIATLAVHAGNQSDPVTHAIFTPIVTASSFIQPNLYEGGDFCYSRVSNPTRKAY
ESALAELEGGIYATATASGMAATNIVMELLPKDAHIIAMKGVYGGTWRLFEKLKTHTTGV
TISYIDLNDEQSLINTIQENTALIWIETPTNPLLELVDIAKVCRIAKERAITTCVDNTFA
SAWNHKPLEMGADMVMLSTSKYVGGHSDLIGGAVITNNEALASRLDFIKTTLGSIASPFD
AYLALRGMKTLDLRMARQCGNALRVAQYLENHPAIASVYYPGLPSHPQHQLCRQQMRSGG
AVVTATLKGDIQSLKRFIGGLHYFVLAESLGGVESMINHSASMSHGAMSKEEREAIGVYD
TTLRFSVGIEHIDDLLQDLESAFAAMDITQDNHHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory