Comparing BWI76_RS16785 FitnessBrowser__Koxy:BWI76_RS16785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 15:382/383 of query aligns to 52:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 93% coverage: 12:367/383 of query aligns to 11:361/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 10:377/383 of query aligns to 47:422/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
33% identity, 97% coverage: 12:381/383 of query aligns to 17:388/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
38% identity, 71% coverage: 10:282/383 of query aligns to 21:292/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
27% identity, 64% coverage: 12:256/383 of query aligns to 19:245/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 75% coverage: 12:297/383 of query aligns to 3:296/373 of 3rzaA
Sites not aligning to the query:
>BWI76_RS16785 FitnessBrowser__Koxy:BWI76_RS16785
MAVSSSLIAEAIRWRRDFHACPELGYQEQETSRRVAELLASFGLQVHRGLAGTGVVATLE
NGPGPVIGLRADMDALPIAEQSDVGYKSRNPGVMHACGHDGHSAMLLATAAHLAQTRRFR
GTVHFVFQPAEENLGGARKMVEEGLFERFPMDAIYALHNWPGMPLGQVAIGSGAMMASLD
AFEITLTGKSCHAAMPERGADPIVAAAQLIMALQTIPSRRLSPQESTVVSITQIAGGEAI
NVLPDKVVLRGTFRCLDNQVRARVRGLIESYVAAQPQVSEVEGAIAWYPGYPVTTNHPAE
AQKVREVATALLGESAVSWNGNPSMASEDFACMLEACPGAYFWIGADGETASKPLHNAGY
DFNDELLPHGVALWTALVEKLLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory