Comparing BWI76_RS16795 FitnessBrowser__Koxy:BWI76_RS16795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
65% identity, 100% coverage: 1:240/240 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
65% identity, 100% coverage: 1:240/240 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
65% identity, 100% coverage: 1:240/240 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
65% identity, 100% coverage: 1:240/240 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
60% identity, 100% coverage: 1:240/240 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
62% identity, 100% coverage: 1:240/240 of query aligns to 2:240/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 100% coverage: 2:240/240 of query aligns to 7:257/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
52% identity, 100% coverage: 2:240/240 of query aligns to 3:253/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 100% coverage: 1:240/240 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 100% coverage: 1:240/240 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 100% coverage: 1:240/240 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 100% coverage: 1:240/240 of query aligns to 2:246/344 of 6cvlD
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
39% identity, 96% coverage: 1:230/240 of query aligns to 3:236/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
39% identity, 96% coverage: 1:230/240 of query aligns to 3:236/615 of 5lilA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
36% identity, 91% coverage: 1:219/240 of query aligns to 3:223/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 91% coverage: 1:219/240 of query aligns to 3:223/230 of 6z4wA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 98% coverage: 2:236/240 of query aligns to 7:243/375 of 2d62A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
41% identity, 91% coverage: 1:219/240 of query aligns to 1:228/232 of 1f3oA
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
37% identity, 98% coverage: 2:236/240 of query aligns to 1:231/367 of 1q12A
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 98% coverage: 2:236/240 of query aligns to 4:234/371 of P68187
Sites not aligning to the query:
>BWI76_RS16795 FitnessBrowser__Koxy:BWI76_RS16795
MIHINNLHKRFGDSHVLRGISCDIKPQEVVCIIGPSGSGKSTFLRCMNALETVSEGEVEV
NGFAAHDRATDLNKMRESVGMVFQRFNLFPHKTVLENLIMAPMNLRGMARAEAVRLAEEL
LAKVGLSDKRDAWPSSLSGGQQQRVAIARALAMKPSIMLFDEPTSALDPELVGDVLEVMK
NLASEGMTMVIVTHEMGFAREVADRVIFIDQGIIQEEGKPAQIFSAPTNPRTAAFLSKVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory