Comparing BWI76_RS16830 FitnessBrowser__Koxy:BWI76_RS16830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 88% coverage: 22:260/273 of query aligns to 23:260/265 of P07821
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
34% identity, 79% coverage: 12:226/273 of query aligns to 2:223/232 of 1f3oA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 83% coverage: 12:237/273 of query aligns to 3:225/241 of 4u00A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 79% coverage: 12:226/273 of query aligns to 2:223/230 of 1l2tA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 84% coverage: 12:241/273 of query aligns to 2:223/240 of 4ymuJ
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
34% identity, 86% coverage: 17:251/273 of query aligns to 9:236/350 of 3fvqB
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
33% identity, 79% coverage: 12:228/273 of query aligns to 341:556/589 of O06967
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
26% identity, 86% coverage: 12:247/273 of query aligns to 2:238/276 of Q5M243
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 89% coverage: 5:246/273 of query aligns to 4:250/257 of P0AAH0
Sites not aligning to the query:
7bg4A Multidrug resistance transporter bmra mutant e504a bound with atp, mg, and rhodamine 6g solved by cryo-em (see paper)
33% identity, 79% coverage: 12:228/273 of query aligns to 324:539/572 of 7bg4A
Sites not aligning to the query:
7ow8A Cryoem structure of the abc transporter bmra e504a mutant in complex with atp-mg (see paper)
33% identity, 79% coverage: 12:228/273 of query aligns to 332:547/577 of 7ow8A
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
29% identity, 95% coverage: 14:272/273 of query aligns to 6:258/262 of 7chaI
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
32% identity, 82% coverage: 12:235/273 of query aligns to 654:874/908 of G7CBF5
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 73% coverage: 27:226/273 of query aligns to 21:219/343 of P30750
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 79% coverage: 10:226/273 of query aligns to 2:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 79% coverage: 10:226/273 of query aligns to 2:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 79% coverage: 10:226/273 of query aligns to 2:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 79% coverage: 10:226/273 of query aligns to 2:216/242 of 2oljA
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 80% coverage: 8:226/273 of query aligns to 605:820/860 of A0R6H8
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 75% coverage: 22:226/273 of query aligns to 16:218/280 of 5x40A
Sites not aligning to the query:
>BWI76_RS16830 FitnessBrowser__Koxy:BWI76_RS16830
MPQRVLPAEQGIVLDSLSAGYGQTLIVDNIHLTIPHGKMTVLAGANGSGKSTLLSTIARM
LKPLGGCVRLDGEVIHQMPTREVSRRLGILPQSPLTPEGLTVFELVSRGRYPWQGLMRQW
SEADERAVEEALMLTGTAEFAHLAVDSLSGGQRQRCWIAMALAQQTATILLDEPTTWLDL
RYQVDILELLQTLTRDHGRTVVTVLHDLNFAVNYADLLVFLKKGQIAGVINEQEICTPEL
IKTVFDVDVQMSLNPQTGKPFFMPFRAREEKAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory