SitesBLAST
Comparing BWI76_RS16840 FitnessBrowser__Koxy:BWI76_RS16840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 83% coverage: 9:226/262 of query aligns to 10:226/378 of P69874
- C26 (≠ A25) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F26) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ S48) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C57) mutation to T: Loss of ATPase activity and transport.
- L60 (= L63) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I79) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ I133) mutation to M: Loss of ATPase activity and transport.
- D172 (= D170) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 72% coverage: 33:220/262 of query aligns to 19:217/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 77% coverage: 33:234/262 of query aligns to 16:219/369 of P19566
- L86 (= L100) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P172) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D177) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 15:218/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S55), G38 (= G56), C39 (= C57), G40 (= G58), K41 (= K59), S42 (= S60), T43 (= T61), Q81 (= Q96), R128 (≠ A141), A132 (≠ Q145), S134 (= S147), G136 (= G149), Q137 (≠ M150), E158 (= E171), H191 (= H204)
- binding magnesium ion: S42 (= S60), Q81 (= Q96)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 15:218/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G56), C39 (= C57), G40 (= G58), K41 (= K59), S42 (= S60), T43 (= T61), R128 (≠ A141), S134 (= S147), Q137 (≠ M150)
- binding beryllium trifluoride ion: S37 (= S55), G38 (= G56), K41 (= K59), Q81 (= Q96), S134 (= S147), G136 (= G149), H191 (= H204)
- binding magnesium ion: S42 (= S60), Q81 (= Q96)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 15:218/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (= V35), G38 (= G56), C39 (= C57), G40 (= G58), K41 (= K59), S42 (= S60), T43 (= T61), R128 (≠ A141), A132 (≠ Q145), S134 (= S147), Q137 (≠ M150)
- binding tetrafluoroaluminate ion: S37 (= S55), G38 (= G56), K41 (= K59), Q81 (= Q96), S134 (= S147), G135 (= G148), G136 (= G149), E158 (= E171), H191 (= H204)
- binding magnesium ion: S42 (= S60), Q81 (= Q96)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 15:218/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (= V35), G38 (= G56), C39 (= C57), G40 (= G58), K41 (= K59), S42 (= S60), T43 (= T61), R128 (≠ A141), A132 (≠ Q145), S134 (= S147), Q137 (≠ M150)
- binding magnesium ion: S42 (= S60), Q81 (= Q96)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 15:218/374 of 2awnB
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 77% coverage: 33:234/262 of query aligns to 16:219/371 of P68187
- A85 (≠ T99) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (vs. gap) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A126) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L129) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ S131) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q136) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G149) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D170) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 77% coverage: 33:234/262 of query aligns to 13:216/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S55), G36 (= G56), C37 (= C57), G38 (= G58), K39 (= K59), S40 (= S60), T41 (= T61), R126 (≠ A141), A130 (≠ Q145), S132 (= S147), G134 (= G149), Q135 (≠ M150)
Sites not aligning to the query:
1g291 Malk (see paper)
38% identity, 72% coverage: 33:220/262 of query aligns to 16:214/372 of 1g291
- binding magnesium ion: D69 (≠ G86), E71 (≠ G88), K72 (≠ P89), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S55), G39 (= G56), C40 (= C57), G41 (= G58), K42 (= K59), T43 (≠ S60), T44 (= T61)
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 78% coverage: 15:219/262 of query aligns to 2:208/393 of P9WQI3
- H193 (= H204) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 70% coverage: 36:219/262 of query aligns to 19:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S55), G39 (= G56), G41 (= G58), K42 (= K59), S43 (= S60), Q82 (= Q96), Q133 (= Q145), G136 (= G148), G137 (= G149), Q138 (≠ M150), H192 (= H204)
- binding magnesium ion: S43 (= S60), Q82 (= Q96)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 70% coverage: 36:219/262 of query aligns to 19:207/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S55), C40 (= C57), G41 (= G58), K42 (= K59), S43 (= S60), T44 (= T61), Q82 (= Q96), R129 (≠ A141), Q133 (= Q145), S135 (= S147), G136 (= G148), G137 (= G149), Q159 (≠ E171), H192 (= H204)
- binding magnesium ion: S43 (= S60), Q82 (= Q96)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 70% coverage: 36:219/262 of query aligns to 17:205/384 of 8hplC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 73% coverage: 38:227/262 of query aligns to 44:242/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
37% identity, 73% coverage: 38:227/262 of query aligns to 44:242/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
41% identity, 81% coverage: 15:227/262 of query aligns to 2:217/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (= F26), Q14 (= Q31), T16 (≠ V33), V18 (= V35), S38 (= S55), G39 (= G56), C40 (= C57), G41 (= G58), K42 (= K59), T43 (≠ S60), T44 (= T61), R133 (≠ A141), E137 (≠ Q145), S139 (= S147), G141 (= G149), Q142 (≠ M150)
- binding calcium ion: T43 (≠ S60), Q86 (= Q96)
7ahdC Opua (e190q) occluded (see paper)
37% identity, 73% coverage: 38:227/262 of query aligns to 44:242/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S55), G62 (= G56), G64 (= G58), K65 (= K59), S66 (= S60), T67 (= T61), Q111 (= Q96), K161 (≠ R144), Q162 (= Q145), S164 (= S147), G166 (= G149), M167 (= M150), Q188 (≠ E171), H221 (= H204)
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 74% coverage: 35:229/262 of query aligns to 18:219/242 of 3c4jA
Sites not aligning to the query:
Query Sequence
>BWI76_RS16840 FitnessBrowser__Koxy:BWI76_RS16840
MVTANARPQAASAGAAVSISHLHHAFSLGKQMVPVLENISLQLRPGESVALLGPSGCGKS
TLLRLLAGLEPQQSGQIQIDEAAMGGPGPERILVFQDPTLYPWLTVRQNVLLGPQAQGKK
GLEPKADALISRIGLQGFSEAWPRQLSGGMAQRAALARALLNEPRLLLLDEPLGKLDSLT
RISMQRELIALWQQQGYTSLLVTHDIEEALLLCERVLVMSPRPGRIIAEFALPLAFPRHR
DNPLLVQHRQDILRILGQEEDW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory