Comparing BWI76_RS16935 FitnessBrowser__Koxy:BWI76_RS16935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
39% identity, 90% coverage: 5:253/278 of query aligns to 2:253/266 of 4k28A
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
30% identity, 90% coverage: 1:250/278 of query aligns to 1:260/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 90% coverage: 1:250/278 of query aligns to 1:260/288 of P0A6D5
Sites not aligning to the query:
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
31% identity, 87% coverage: 8:250/278 of query aligns to 2:254/280 of 1o9bA
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
27% identity, 89% coverage: 3:250/278 of query aligns to 9:266/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
27% identity, 89% coverage: 3:250/278 of query aligns to 9:266/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
27% identity, 89% coverage: 3:250/278 of query aligns to 6:263/288 of 3tnlA
Sites not aligning to the query:
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
30% identity, 90% coverage: 1:250/278 of query aligns to 1:260/288 of Q8ZPR4
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
25% identity, 95% coverage: 11:273/278 of query aligns to 9:270/278 of Q9KVT3
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
25% identity, 95% coverage: 11:273/278 of query aligns to 5:266/272 of 3pgjA
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
27% identity, 76% coverage: 64:273/278 of query aligns to 53:262/268 of 3sefA
P56119 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
28% identity, 85% coverage: 13:249/278 of query aligns to 9:234/263 of P56119
Sites not aligning to the query:
4fosA Crystal structure of shikimate dehydrogenase (aroe) q237a mutant from helicobacter pylori in complex with shikimate
28% identity, 85% coverage: 13:249/278 of query aligns to 9:234/263 of 4fosA
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
29% identity, 68% coverage: 62:249/278 of query aligns to 54:236/269 of Q5HNV1
Sites not aligning to the query:
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 90% coverage: 2:250/278 of query aligns to 1:240/267 of 2hk9B
Sites not aligning to the query:
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 90% coverage: 2:250/278 of query aligns to 1:240/269 of 2hk9A
Sites not aligning to the query:
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
25% identity, 90% coverage: 2:250/278 of query aligns to 1:240/269 of O67049
Sites not aligning to the query:
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
31% identity, 84% coverage: 13:246/278 of query aligns to 7:231/271 of 1nytA
Sites not aligning to the query:
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
31% identity, 84% coverage: 13:246/278 of query aligns to 7:231/272 of P15770
Sites not aligning to the query:
3jyqA Quinate dehydrogenase from corynebacterium glutamicum in complex with shikimate and nadh (see paper)
33% identity, 71% coverage: 64:260/278 of query aligns to 64:265/282 of 3jyqA
Sites not aligning to the query:
>BWI76_RS16935 FitnessBrowser__Koxy:BWI76_RS16935
MVISGNTRLIAHLGYPTAKFKAPMIYNPWLVHQQVDAKVVPMGVKPEDYAAFVPMLFKMT
NIIGALVTMPHKIATCGLVQRLSPTAAIAGACNAIRAEADGTLSGDMFDGEGFVLGIKRK
GFQTRGARALVVGSGGVGSAIAASLAAAGVSALTLYDVRSQTAEALAGRLLQHYPRLDIT
LMRRDPQGHDLVVNATPLGMKEGDPLPLDPQRLTPGTFVGEVVMAQEFTPLLQAARAAGC
PIQRGTDMLFEMIPAYLRFFNLPVATPEQLRELAEIRY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory