SitesBLAST
Comparing BWI76_RS17050 FitnessBrowser__Koxy:BWI76_RS17050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
25% identity, 48% coverage: 52:540/1018 of query aligns to 45:464/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I80), G75 (= G85), S76 (≠ G86), G77 (= G87), T78 (= T88), G79 (= G89), L80 (≠ T90), A83 (≠ Q93), C84 (≠ A94), P137 (≠ S147), G138 (≠ T148), E139 (≠ S149), A142 (= A152), T143 (= T153), G146 (= G156), N147 (≠ M157), S149 (≠ N159), T150 (= T160), A152 (= A162), G153 (≠ S163), E203 (= E265), G204 (= G266), I209 (= I271), E422 (= E499), H423 (= H500)
- binding fe (iii) ion: H377 (= H455), H384 (= H462), E422 (= E499)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W323 (vs. gap), E414 (= E499), H415 (= H500), N451 (= N535)
- binding manganese (ii) ion: H370 (= H455), H377 (= H462), E414 (= E499)
- binding pyruvic acid: R319 (= R402), H370 (= H455), H377 (= H462), H415 (= H500)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W322 (vs. gap), E413 (= E499), H414 (= H500), N450 (= N535)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R402), H369 (= H455), H376 (= H462), H414 (= H500)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E413 (= E499)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R402), H369 (= H455), H376 (= H462), H414 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W322 (vs. gap), E413 (= E499), H414 (= H500), N450 (= N535)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E413 (= E499)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
24% identity, 52% coverage: 14:539/1018 of query aligns to 1:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R402), W322 (vs. gap), H369 (= H455), H376 (= H462), H414 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W322 (vs. gap), E413 (= E499), N450 (= N535)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E413 (= E499)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W322 (vs. gap), E413 (= E499), H414 (= H500), N450 (= N535)
- binding lactic acid: R318 (= R402), H369 (= H455), H376 (= H462), H414 (= H500)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E413 (= E499)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
24% identity, 52% coverage: 14:539/1018 of query aligns to 1:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ G87), R317 (≠ L409), W321 (≠ K413), H368 (= H455), H375 (= H462), H413 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W321 (≠ K413), Y322 (≠ G414), E412 (= E499), H413 (= H500), N449 (= N535)
- binding manganese (ii) ion: H368 (= H455), H375 (= H462), E412 (= E499)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R402), W322 (vs. gap), H369 (= H455), H376 (= H462), H413 (= H500)
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), W322 (vs. gap), E412 (= E499), H413 (= H500), N449 (= N535)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E412 (= E499)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R402), W322 (vs. gap), S336 (≠ A422), H369 (= H455), H376 (= H462), H413 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), E412 (= E499), N449 (= N535)
- binding manganese (ii) ion: H369 (= H455), H376 (= H462), E412 (= E499)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), Y324 (≠ V406), H370 (= H455), E414 (= E499), N451 (= N535)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R402), W323 (vs. gap), H415 (= H500)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R402), W323 (vs. gap), H370 (= H455), H415 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), H370 (= H455), E414 (= E499), N451 (= N535)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R402), W323 (vs. gap), H415 (= H500)
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), Y324 (≠ V406), H370 (= H455), E414 (= E499), N451 (= N535)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), H370 (= H455), E414 (= E499), N451 (= N535)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R402), W323 (vs. gap), H415 (= H500)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), H370 (= H455), E414 (= E499), N451 (= N535)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R402), H415 (= H500)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:455/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), Y324 (≠ V406), H370 (= H455), E414 (= E499), N451 (= N535)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ G87), R319 (= R402), W323 (vs. gap), H415 (= H500)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
23% identity, 52% coverage: 14:539/1018 of query aligns to 1:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ I80), G70 (≠ T82), T71 (≠ P83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ M103), P132 (≠ T148), G133 (≠ S149), A134 (≠ N150), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E265), G201 (= G266), I206 (= I271), H369 (= H455), E413 (= E499), N450 (= N535)
- binding deaminohydroxyvaline: R319 (= R402), H414 (= H500)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
24% identity, 48% coverage: 55:540/1018 of query aligns to 44:465/465 of 3pm9A
- active site: A149 (= A162), L159 (≠ K172)
- binding flavin-adenine dinucleotide: P69 (= P83), Q70 (≠ R84), G71 (= G85), G72 (= G86), N73 (≠ G87), T74 (= T88), G75 (= G89), L76 (vs. gap), G79 (= G92), Q80 (= Q93), L91 (≠ S104), L133 (= L146), G134 (≠ S147), A135 (≠ T148), C139 (≠ A152), T140 (= T153), G142 (= G155), G143 (= G156), S146 (≠ N159), T147 (= T160), A149 (= A162), G150 (≠ S163), E200 (= E265), G201 (= G266), I205 (≠ F270), I206 (= I271), E423 (= E499)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
23% identity, 48% coverage: 55:543/1018 of query aligns to 103:520/521 of Q8N465
- S109 (≠ T61) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ T82) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G86) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (= I100) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M107) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V126) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A143) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ N159) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ I185) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G187) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D391) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R402) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ V406) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ A415) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K417) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R440) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G447) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H455) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ D457) to V: slight reduction in catalytic activity
- N439 (≠ V460) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H462) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ R464) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ P465) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ L467) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E499) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H500) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G501) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
23% identity, 48% coverage: 55:541/1018 of query aligns to 51:466/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P83), G78 (= G85), G79 (= G86), N80 (≠ G87), T81 (= T88), G82 (= G89), M83 (≠ T90), G86 (≠ Q93), S87 (≠ A94), L140 (= L146), A142 (≠ T148), C146 (≠ A152), H147 (≠ T153), G150 (= G156), N151 (≠ M157), A153 (≠ N159), T154 (= T160), G208 (= G266), I212 (≠ F270), I213 (= I271), E423 (= E499), N460 (= N535)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
23% identity, 48% coverage: 55:541/1018 of query aligns to 50:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R402), T337 (≠ V406), K348 (≠ A422), Y379 (≠ F453), H381 (= H455), H388 (= H462), H423 (= H500)
- binding flavin-adenine dinucleotide: P75 (= P83), Q76 (≠ R84), G77 (= G85), G78 (= G86), N79 (≠ G87), T80 (= T88), G81 (= G89), M82 (≠ T90), G85 (≠ Q93), S86 (≠ A94), L139 (= L146), G140 (≠ S147), A141 (≠ T148), C145 (≠ A152), G149 (= G156), N150 (≠ M157), A152 (≠ N159), T153 (= T160), G157 (= G164), G207 (= G266), I212 (= I271), E422 (= E499), N459 (= N535)
- binding zinc ion: H381 (= H455), H388 (= H462), E422 (= E499)
Sites not aligning to the query:
Query Sequence
>BWI76_RS17050 FitnessBrowser__Koxy:BWI76_RS17050
MIPQISQAPGVVQLVLNFLQVLEQQGFTGDTATSYADRLTMATDNSVYQLLPDAIIFPRS
TADVALLARLAAEERFKSLIFTPRGGGTGTNGQALNAGIIVDMSRYMNRIIEINPEEGWV
RVEAGVIKDQLNQFLKPYGYFFAPELSTSNRATLGGMINTDASGQGSLVYGKTSDHVLGV
RSVLIGGDILDTQPIPVALAETLSAQQSAIGRIYRTVYQRCKAQRQLVIDKFPKLNRFLT
GYDLRHVFNDEMSEFDLTRILTGSEGTLAFITEARLDITRLPKVRRLVNVKYDSFNSALR
NAPFMVEARALSVETVDSKVLNLAREDIVWHSVSELITDVADKEMLGLNIVEFAGDDVEL
IDSQVTALCQRLDELISRNEAGVIGWQVCHDLDGVERIYAMRKKAVGLLGNAKGAAKPIP
FAEDTCVPPEHLADYIAEFRALLDGHGLSYGMFGHVDAGVLHVRPALDMCDPQQEMLMKR
ISDDVVALTAKYGGLLWGEHGKGFRAEYSPAFFGEALFGELRKIKAAFDPDNRLNPGKIC
PPEGVDAPMMKVDAVKRGTFDRQIPIAVRSSWRGAMECNGNGLCFNFDAKSPMCPSMKVS
NHRIHSPKGRATLVREWLRLLADRGIDPNQLEKDLPEKRASLRTLVERTRNSWHARKGEY
DFSHEVKEAMSGCLACKACSTQCPIKIDVPEFRSRFLQLYHSRYLRPVRDHLVATVESYA
PLMAHAPKTFNFFINQPWMRKLSEKHIGMVDLPLLSVPSLKQQMVGHRSANTTLEQLEEL
SAEQKAKMVLVVQDPFTSYYDAQVVADFVRLVEKVGYQPVLLPFSPNGKAQHIKGFLTRF
ARTAQKTADFLNRVAELGMPMVGVDPALVLCYRDEYNQVLGDKRGDFRVMLVHEWLPQAL
SETAAQDKGGESWYLFGHCTEVTALPASTRQWADIFARFGAKLENVSVGCCGMAGTYGHE
VKNHANSLAIYALSWQQAMERLPRNRCLVTGYSCRSQVKRIEGSGVRHPLQALLEIMG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory