Comparing BWI76_RS17175 FitnessBrowser__Koxy:BWI76_RS17175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
79% identity, 99% coverage: 1:307/310 of query aligns to 1:307/309 of 3uqdB
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
79% identity, 99% coverage: 1:307/310 of query aligns to 1:307/309 of 3uqdA
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
79% identity, 99% coverage: 1:307/310 of query aligns to 1:307/309 of 3n1cA
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
79% identity, 99% coverage: 1:307/310 of query aligns to 1:307/309 of P06999
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
79% identity, 99% coverage: 1:307/310 of query aligns to 1:305/307 of 3uqeA
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
78% identity, 99% coverage: 1:307/310 of query aligns to 1:302/304 of 3cqdA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 98% coverage: 3:305/310 of query aligns to 13:314/339 of P9WID3
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
28% identity, 96% coverage: 4:302/310 of query aligns to 3:302/319 of 2f02A
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
27% identity, 92% coverage: 4:287/310 of query aligns to 3:281/309 of 3ie7A
Sites not aligning to the query:
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
27% identity, 92% coverage: 4:287/310 of query aligns to 3:274/298 of 3julA
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
26% identity, 98% coverage: 4:307/310 of query aligns to 3:314/320 of 2ajrA
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
26% identity, 88% coverage: 4:277/310 of query aligns to 10:283/318 of 2jg1A
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
26% identity, 88% coverage: 4:277/310 of query aligns to 7:280/315 of 2jg1C
Sites not aligning to the query:
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
26% identity, 88% coverage: 4:277/310 of query aligns to 6:279/314 of 2jgvB
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
27% identity, 83% coverage: 37:293/310 of query aligns to 35:285/300 of 8cqxA
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
24% identity, 61% coverage: 95:284/310 of query aligns to 100:287/313 of 6ilsB
Sites not aligning to the query:
2fv7A Crystal structure of human ribokinase
27% identity, 77% coverage: 38:277/310 of query aligns to 38:278/308 of 2fv7A
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 61% coverage: 95:284/310 of query aligns to 166:353/379 of A1A6H3
Sites not aligning to the query:
5c3yA Structure of human ribokinase crystallized with amppnp
27% identity, 77% coverage: 38:277/310 of query aligns to 38:278/306 of 5c3yA
Sites not aligning to the query:
5byfA Crystal structure of human ribokinase in complex with amp
27% identity, 77% coverage: 38:277/310 of query aligns to 40:280/313 of 5byfA
Sites not aligning to the query:
>BWI76_RS17175 FitnessBrowser__Koxy:BWI76_RS17175
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGSATAIFP
VGGATGEHLTALLTDEHVPVDTVETHDWTRQNLHVHVNASGEQYRFVMPGAALTADELRL
IEEKVLTIAPGSLLVISGSLPPGISVENLTQLVKNAQRHGLRCIVDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQELIRSGKVQRVVVSLGAQGALGVDADGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSQENT
QKIYDYLRGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory