Comparing BWI76_RS17520 FitnessBrowser__Koxy:BWI76_RS17520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P0A2X8 Carbamate kinase 1; EC 2.7.2.2 from Enterococcus faecium (Streptococcus faecium) (see 2 papers)
52% identity, 95% coverage: 1:293/310 of query aligns to 1:292/310 of P0A2X8
2we5A Carbamate kinase from enterococcus faecalis bound to mgadp (see paper)
52% identity, 94% coverage: 3:293/310 of query aligns to 2:291/309 of 2we5A
2we4A Carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate (see paper)
52% identity, 94% coverage: 3:293/310 of query aligns to 2:291/309 of 2we4A
1e19A Structure of the carbamate kinase-like carbamoyl phosphate synthetase from the hyperthermophilic archaeon pyrococcus furiosus bound to adp (see paper)
48% identity, 98% coverage: 3:306/310 of query aligns to 2:309/313 of 1e19A
4jz8A Carbamate kinase from giardia lamblia bound to citric acid (see paper)
43% identity, 99% coverage: 3:308/310 of query aligns to 5:313/316 of 4jz8A
4jz7C Carbamate kinase from giardia lamblia bound to amp-pnp (see paper)
43% identity, 99% coverage: 3:308/310 of query aligns to 5:313/316 of 4jz7C
4axsA Structure of carbamate kinase from mycoplasma penetrans (see paper)
44% identity, 98% coverage: 4:308/310 of query aligns to 1:289/291 of 4axsA
4olcA Carbamate kinase from giardia lamblia thiocarbamoylated by disulfiram on cys242 (see paper)
42% identity, 99% coverage: 3:308/310 of query aligns to 4:305/308 of 4olcA
8crvA Crystal structure of the carbamate kinase from pseudomonas aeruginosa
42% identity, 99% coverage: 4:309/310 of query aligns to 4:303/312 of 8crvA
4jz7A Carbamate kinase from giardia lamblia bound to amp-pnp (see paper)
39% identity, 99% coverage: 3:308/310 of query aligns to 5:282/285 of 4jz7A
>BWI76_RS17520 FitnessBrowser__Koxy:BWI76_RS17520
MSKKIVLALGGNALGDDLAGQMQAVRHTARTIVDLIALGHQVVVTHGNGPQVGMINQAFE
AAAKTEAHTPMLPMSVCVALSQGYIGYDLQNAIREELLSRQLDIPVATLITQVEVDANDE
AFLNPTKPIGSFFSKEEAEKLSQNGYIMKEDAGRGYRRVVASPKPVDIIEKQTVKALMDD
CHVVITVGGGGIPVIREGNHLRGASAVIDKDWASAKLAETIDADLLIILTAVEKVAINFG
KPGEQWLDNLSLRDAERFIAEGHFAKGSMLPKVEAAAAFARSRPGRQALITMLSKAKEGI
EGKTGTIISQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory