SitesBLAST
Comparing BWI76_RS17580 FitnessBrowser__Koxy:BWI76_RS17580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
38% identity, 90% coverage: 31:461/479 of query aligns to 21:437/446 of A0A0H2VG78
- D22 (= D32) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R112) mutation to A: Loss of transport activity.
- I105 (≠ L115) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E132) mutation to A: Loss of transport activity.
- Q137 (≠ E147) mutation to A: Loss of transport activity.
- Q250 (= Q273) mutation to A: Loss of transport activity.
- Q251 (= Q274) mutation to A: Loss of transport activity.
- N256 (= N279) mutation to A: Loss of transport activity.
- W357 (= W381) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 92% coverage: 18:459/479 of query aligns to 34:477/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 7:458/479 of query aligns to 1:475/491 of P0AGF4
- F24 (= F29) mutation to A: Decreases xylose transport.
- G83 (= G80) mutation to A: Abolishes xylose transport.
- R133 (= R112) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E132) mutation to A: Abolishes xylose transport.
- R160 (= R139) mutation to A: Abolishes xylose transport.
- Q168 (≠ E147) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q273) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 273:274) binding
- Q289 (= Q274) mutation to A: Strongly decreases xylose transport.
- N294 (= N279) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y283) mutation to A: Abolishes xylose transport.
- N325 (≠ S310) mutation to A: No effect on xylose transport.
- G340 (≠ K326) mutation to A: Abolishes xylose transport.
- R341 (= R327) mutation R->A,W: Abolishes xylose transport.
- W392 (= W381) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E386) mutation to A: Abolishes xylose transport.
- R404 (= R393) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ M404) binding
- W416 (= W405) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
33% identity, 93% coverage: 15:458/479 of query aligns to 6:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
33% identity, 93% coverage: 15:458/479 of query aligns to 6:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
33% identity, 93% coverage: 15:458/479 of query aligns to 6:471/475 of 4gbyA
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 68% coverage: 15:341/479 of query aligns to 27:357/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
29% identity, 92% coverage: 19:457/479 of query aligns to 9:465/487 of 7aaqA
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 92% coverage: 19:457/479 of query aligns to 29:485/514 of Q9LT15
- F39 (= F29) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ T33) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (vs. gap) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E132) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (≠ E147) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ Q154) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q273) binding
- Q296 (= Q274) binding
- N301 (= N279) binding
- N332 (≠ S310) binding
- D344 (= D323) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W381) binding
- C449 (≠ L418) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
30% identity, 94% coverage: 21:469/479 of query aligns to 16:477/493 of P32037
- N43 (≠ A48) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
29% identity, 92% coverage: 19:457/479 of query aligns to 14:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ T33), I90 (≠ F75), H94 (≠ F79), V98 (≠ K83), F101 (≠ L86), N138 (≠ S123), P142 (= P127), N158 (≠ T143), F161 (≠ N146), Q162 (≠ E147), I165 (= I150), D210 (≠ E198), G391 (= G377), P392 (≠ F378), W395 (= W381), M419 (≠ V401)
- binding beta-D-glucopyranose: Q280 (= Q273), N286 (= N279), M289 (= M282), G391 (= G377), W395 (= W381)
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 66% coverage: 17:332/479 of query aligns to 30:345/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
28% identity, 91% coverage: 22:457/479 of query aligns to 19:463/492 of P11166
- N34 (= N37) to S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- N45 (≠ A48) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to T: Loss of glycosylation site.
- R51 (vs. gap) to H: in EIG12; uncertain significance; dbSNP:rs201815571
- T60 (= T53) to M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- M77 (≠ A66) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G80) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R112) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G116) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ S123) binding
- P149 (= P135) to A: in EIG12; uncertain significance
- R153 (= R139) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (= L155) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (≠ V181) mutation to C: Strongly decreases glucose transport.
- L204 (≠ M193) mutation to C: Abolishes glucose transport.
- P205 (≠ L194) mutation to C: Abolishes glucose transport.
- R212 (= R201) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (≠ K206) to S: in EIG12; decreased glucose transport
- R223 (≠ E211) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ E214) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (= R220) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (≠ D231) to V: in EIG12; decreased glucose transport
- A275 (≠ G266) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (= Q273) binding
- QQLS 282:285 (≠ QQTT 273:276) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (= G277) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (= T286) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ F294) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (≠ N303) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ G313) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D323) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R327) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G334) mutation to C: Strongly decreases glucose transport.
- W388 (= W381) binding
- N411 (≠ M404) Not glycosylated; binding ; to S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- I435 (≠ L429) natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- R458 (≠ K452) to W: in EIG12; decreased glucose transport; dbSNP:rs13306758
Sites not aligning to the query:
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
28% identity, 91% coverage: 22:457/479 of query aligns to 19:463/492 of P17809
- N45 (≠ A48) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
W7MAT5 Myo-inositol transporter FST1 from Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) (see paper)
29% identity, 91% coverage: 22:458/479 of query aligns to 83:523/574 of W7MAT5
- IRG 276:278 (≠ IRP 219:221) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- R277 (= R220) mutation R->G,K: Abolishes production of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
- VVS 295:297 (≠ IKA 236:238) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- EEI 520:522 (≠ EQL 455:457) mutation Missing: Abolishes transporter activity. Abolishes synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production.
Sites not aligning to the query:
- 546:548 mutation Missing: Abolishes transporter activity. Strongly decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1), severely decreases macroconidia production, results in hydrogen peroxide sensitivity, and decreases virulence in maize kernels.
- 547 L→D: Decreases transporter activity. Moderately decreases synthesis of the polyketide mycotoxin fumonisin B1 (FB1).
5eqiA Human glut1 in complex with cytochalasin b (see paper)
29% identity, 89% coverage: 22:449/479 of query aligns to 11:447/447 of 5eqiA
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
29% identity, 89% coverage: 22:449/479 of query aligns to 11:447/447 of 5eqhA
5eqgA Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
29% identity, 89% coverage: 22:449/479 of query aligns to 11:447/447 of 5eqgA
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
28% identity, 91% coverage: 21:457/479 of query aligns to 13:458/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F29), T25 (= T33), N29 (= N37), Q156 (≠ E147), I163 (≠ Q154), Q278 (= Q274), F286 (≠ M282), A308 (≠ C302), N312 (= N306), F374 (≠ M372), E375 (≠ Q373), N406 (≠ M404), W407 (= W405), N410 (= N408)
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
28% identity, 91% coverage: 21:457/479 of query aligns to 16:461/470 of 7sptA
Query Sequence
>BWI76_RS17580 FitnessBrowser__Koxy:BWI76_RS17580
MSLIMNLNLQQRKRLHQITLVATFGGLLFGYDTGVINGAFSSLKQYMALTPTTEGLVMSV
LLIGAALGSVFGGKFADFFGRRKYLLFLSFIFFIGALMSALAPDITVLLISRFILGYAVG
GASVTAPTFISEVAPTEMRGKLTGLNEVAIVIGQLAAFAINAIIGILWGHLPDVWRYMLM
VQTIPAICLFIGMLRSPESPRWLISKNRHEEALEILKQIRPLERATKEFNDITTLIKAEA
DKKLHSQNAFITILQTPWIFKLLLVGVIWAALQQTTGVNVIMYYGTEILSSAGFSERTSL
ICNVLNGVFSVGGMLFGVLFLVDRFKRKTIIIYGFALMATLHLIIAGVDYTLVGDIKATA
IWLLGAMFVGVMQGTMGFITWVVLAELFPLKFRGLSMGISVFFMWVMNAIVSYLFPLLQA
KLGLGPVFLIFAAINYLAIVFVITALPETSNKSLEQLEEELSANKSTAGFNTATKESGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory