Comparing BWI76_RS17585 FitnessBrowser__Koxy:BWI76_RS17585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
31% identity, 98% coverage: 2:142/144 of query aligns to 1:141/143 of C0H3V2
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
29% identity, 92% coverage: 8:140/144 of query aligns to 7:141/144 of 1j6tA
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 92% coverage: 8:140/144 of query aligns to 499:633/637 of P00550
Sites not aligning to the query:
>BWI76_RS17585 FitnessBrowser__Koxy:BWI76_RS17585
MIDTITQDNLHLSCRAKNKAEVLAMIGADFRSRGYVSEDCVAFLAERERQVSTFLGNGIT
LPHLPKSATSIIVKTGVEIYQFPDGVIWDRNNVMFIAIGVIAKESEHIDVLREVASIFSD
EVIARALSLIANKEDFLRILQQNH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory