SitesBLAST
Comparing BWI76_RS17730 FitnessBrowser__Koxy:BWI76_RS17730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a2fA Crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa (see paper)
49% identity, 98% coverage: 3:352/356 of query aligns to 2:353/358 of 6a2fA
- active site: K34 (= K35), R130 (= R130), H159 (= H159), R209 (= R207), Y254 (= Y253), S301 (= S300), D303 (= D302)
- binding acetate ion: Y254 (= Y253), R279 (= R278), L340 (≠ V339), Y342 (= Y341)
- binding d-lysine: Y254 (= Y253), Y273 (= Y272), S301 (= S300), M302 (= M301), D303 (= D302), M304 (= M303)
- binding malonate ion: K123 (= K123), R130 (= R130), L131 (= L131)
1rcqA The 1.45 a crystal structure of alanine racemase from a pathogenic bacterium, pseudomonas aeruginosa, contains both internal and external aldimine forms (see paper)
47% identity, 99% coverage: 3:354/356 of query aligns to 2:353/357 of 1rcqA
- active site: K33 (= K35), R129 (= R130), H158 (= H159), R208 (= R207), Y253 (= Y253), S300 (= S300), D302 (= D302)
- binding d-lysine: K33 (= K35), R129 (= R130), Y341 (= Y341)
- binding pyridoxal-5'-phosphate: V31 (= V33), K33 (= K35), Y37 (= Y39), H158 (= H159), N192 (= N191), S193 (= S192), R208 (= R207), G210 (= G209), I211 (= I210), Y341 (= Y341)
Q9HTQ2 Alanine racemase, catabolic; EC 5.1.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
47% identity, 99% coverage: 3:354/356 of query aligns to 2:353/357 of Q9HTQ2
- K33 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K123) modified: N6-carboxylysine
2rjhA Crystal structure of biosynthetic alaine racemase in d-cycloserine- bound form from escherichia coli (see paper)
46% identity, 96% coverage: 9:351/356 of query aligns to 8:353/359 of 2rjhA
- active site: K34 (= K35), R129 (= R130), H159 (= H159), R209 (= R207), Y255 (= Y253), A302 (≠ S300), D304 (= D302)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K34 (= K35), Y38 (= Y39), R129 (= R130), H159 (= H159), A193 (≠ N191), S194 (= S192), R209 (= R207), G211 (= G209), I212 (= I210), Y255 (= Y253), A302 (≠ S300), M303 (= M301), Y343 (= Y341)
P0A6B4 Alanine racemase, biosynthetic; EC 5.1.1.1 from Escherichia coli (strain K12) (see paper)
46% identity, 96% coverage: 9:351/356 of query aligns to 8:353/359 of P0A6B4
- K34 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K123) modified: N6-carboxylysine
- D164 (≠ E164) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- E165 (≠ N165) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- P219 (= P217) mutation to A: No effect on catalytic activity. No effect on affinity for D-Ala and L-Ala.
- E221 (≠ G219) mutation E->A,K,P: Slightly increases catalytic activity. Slightly increases affinity for D-Ala and L-Ala.
4xbjA Y274f alanine racemase from e. Coli inhibited by l-ala-p (see paper)
45% identity, 96% coverage: 9:351/356 of query aligns to 6:351/357 of 4xbjA
- active site: K32 (= K35), R127 (= R130), H157 (= H159), R207 (= R207), Y253 (= Y253), A300 (≠ S300), D302 (= D302)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: V30 (= V33), K32 (= K35), Y36 (= Y39), R127 (= R130), H157 (= H159), A191 (≠ N191), S192 (= S192), R207 (= R207), G209 (= G209), I210 (= I210), Y253 (= Y253), A300 (≠ S300), M301 (= M301), Y341 (= Y341)
3b8tA Crystal structure of escherichia coli alaine racemase mutant p219a (see paper)
45% identity, 96% coverage: 9:351/356 of query aligns to 8:353/359 of 3b8tA
- active site: K34 (= K35), R129 (= R130), H159 (= H159), R209 (= R207), Y255 (= Y253), A302 (≠ S300), D304 (= D302)
- binding pyridoxal-5'-phosphate: V32 (= V33), K34 (= K35), Y38 (= Y39), L78 (= L79), H159 (= H159), A193 (≠ N191), S194 (= S192), R209 (= R207), G211 (= G209), I212 (= I210), Y343 (= Y341)
P0A2W8 Alanine racemase; EC 5.1.1.1 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
38% identity, 98% coverage: 3:352/356 of query aligns to 7:363/367 of P0A2W8
- K129 (= K123) modified: N6-carboxylysine
3e5pB Crystal structure of alanine racemase from e.Faecalis (see paper)
36% identity, 98% coverage: 3:352/356 of query aligns to 7:367/371 of 3e5pB
- active site: K40 (= K35), R139 (= R130), H169 (= H159), R222 (= R207), Y267 (= Y253), C313 (≠ S300), D315 (= D302)
- binding pyridoxal-5'-phosphate: K40 (= K35), Y44 (= Y39), R139 (= R130), H169 (= H159), S207 (= S192), G224 (= G209), V225 (≠ I210), Y356 (= Y341)
3e6eA Crystal structure of alanine racemase from e.Faecalis complex with cycloserine (see paper)
36% identity, 98% coverage: 3:352/356 of query aligns to 6:366/370 of 3e6eA
- active site: K39 (= K35), R138 (= R130), H168 (= H159), R221 (= R207), Y266 (= Y253), C312 (≠ S300), D314 (= D302)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K39 (= K35), Y43 (= Y39), L85 (= L79), R138 (= R130), H168 (= H159), S206 (= S192), R221 (= R207), G223 (= G209), V224 (≠ I210), Y266 (= Y253), Y285 (= Y272), M313 (= M301), Y355 (= Y341)
7xllA Alanine racemase from lactobacillus sakei uonuma-1. (see paper)
35% identity, 99% coverage: 3:354/356 of query aligns to 7:373/378 of 7xllA
Sites not aligning to the query:
1ftxA Crystal structure of alanine racemase in complex with d-alanine phosphonate
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/380 of 1ftxA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: K38 (= K35), Y42 (= Y39), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y264 (= Y253), C310 (≠ S300), M311 (= M301), Y353 (= Y341)
1bd0A Alanine racemase complexed with alanine phosphonate (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/381 of 1bd0A
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: K38 (= K35), Y42 (= Y39), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y264 (= Y253), C310 (≠ S300), M311 (= M301), Y353 (= Y341)
P10724 Alanine racemase; EC 5.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 8 papers)
38% identity, 98% coverage: 7:354/356 of query aligns to 10:367/388 of P10724
- K39 (= K35) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Loss of activity.
- K129 (= K123) modified: N6-carboxylysine
- R136 (= R130) binding
- H166 (= H159) mutation to A: 6.5-fold decrease in activity.
- R219 (= R207) mutation to A: 100-fold decrease in activity.; mutation to E: 1000-fold decrease in activity.; mutation to K: 4-fold decrease in activity.
- Y265 (= Y253) mutation to A: 5000-fold decrease in activity.; mutation to F: Loss of activity.; mutation to S: 2000-fold decrease in activity.
- M312 (= M301) binding
- Y354 (= Y341) mutation to A: 54-fold increase in serine racemase activity.; mutation to N: 81-fold increase in serine racemase activity.; mutation to Q: 51-fold increase in serine racemase activity.
1l6gA Alanine racemase bound with n-(5'-phosphopyridoxyl)-d-alanine (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1l6gA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding n-(5'-phosphopyridoxyl)-d-alanine: K38 (= K35), Y42 (= Y39), R135 (= R130), H165 (= H159), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y264 (= Y253), C310 (≠ S300), M311 (= M301), Y353 (= Y341)
1l6fA Alanine racemase bound with n-(5'-phosphopyridoxyl)-l-alanine (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1l6fA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding alanyl-pyridoxal-5'-phosphate: K38 (= K35), Y42 (= Y39), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y264 (= Y253), C310 (≠ S300), M311 (= M301), Y353 (= Y341)
1epvA Alanine racemase with bound inhibitor derived from d- cycloserine (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1epvA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K38 (= K35), Y42 (= Y39), L84 (= L79), R135 (= R130), H165 (= H159), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y264 (= Y253), C310 (≠ S300), M311 (= M301), Y353 (= Y341)
1sftA Alanine racemase (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1sftA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), Y264 (= Y253), C310 (≠ S300), D312 (= D302)
- binding pyridoxal-5'-phosphate: K38 (= K35), Y42 (= Y39), L84 (= L79), R135 (= R130), H165 (= H159), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y353 (= Y341)
1xqlA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1xqlA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), F264 (≠ Y253), C310 (≠ S300), D312 (= D302)
- binding (r)-4-amino-isoxazolidin-3-one: F264 (≠ Y253), M311 (= M301)
- binding pyridoxal-5'-phosphate: K38 (= K35), Y42 (= Y39), L84 (= L79), H165 (= H159), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y353 (= Y341)
- binding (5-hydroxy-4-{[(3-hydroxyisoxazol-4-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: K38 (= K35), Y42 (= Y39), L84 (= L79), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), F264 (≠ Y253), Y283 (= Y272), M311 (= M301), Y353 (= Y341)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: Y42 (= Y39), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), Y353 (= Y341)
1xqkA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
38% identity, 98% coverage: 7:354/356 of query aligns to 9:366/382 of 1xqkA
- active site: K38 (= K35), R135 (= R130), H165 (= H159), R218 (= R207), F264 (≠ Y253), C310 (≠ S300), D312 (= D302)
- binding (5-hydroxy-4-{[(3-hydroxyisoxazol-4-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: K38 (= K35), Y42 (= Y39), L84 (= L79), R135 (= R130), H165 (= H159), N202 (= N191), S203 (= S192), R218 (= R207), G220 (= G209), I221 (= I210), F264 (≠ Y253), M311 (= M301), Y353 (= Y341)
Query Sequence
>BWI76_RS17730 FitnessBrowser__Koxy:BWI76_RS17730
MSRPVKASIDMSALRQNQQIVRRAAPASRLWAVVKANAYGHGLARVWNALSAADGFAMLN
LEEAILLRELGWKGPILMLEGFFHADELALFDKYRLTTSVHSNWQIKALQQAKLHAPLDI
YVKVNSGMNRLGFMPDRLHIVWQQLRSLHNVSEMTLMSHFAEAENPDGIVEPMRRIEQAA
EGLDCPRSLANSAATLWHPESHFNWVRPGIVLYGASPSGLWQDVANTGLKPVMTLSSEII
AVQNLKAGEAVGYGATWRTAEERRIGIVACGYADGYPRLAPSGTPVLVDGVRTATVGRIS
MDMLAVDLTPCPQAGIGAPVELWGKEIKIDDVASACGTVGYELMCALAPRVPVVTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory