Comparing BWI76_RS17835 FitnessBrowser__Koxy:BWI76_RS17835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
32% identity, 83% coverage: 48:279/279 of query aligns to 55:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
29% identity, 76% coverage: 68:279/279 of query aligns to 84:296/296 of P68183
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
38% identity, 27% coverage: 141:215/279 of query aligns to 171:254/313 of P94529
>BWI76_RS17835 FitnessBrowser__Koxy:BWI76_RS17835
MLSKRWDTAGRWCIYALLLIVFVGPFWGIVATAFSGAPVKPGELLAWPNQFSFENFIFAW
MDIGVWQYLLNSILVVFFGTVLQVSVSALAAYALARKKFRGVALVSLVILSTMMLPEEVI
AIPLYMIINWRLPFIDASLYNSYLGMILPVVGWAFSIFVLTEFMSAIPKELEEAARIDGA
NEWQIFFHVILPLVKPALGTVVTFGFIMIWDQYLLPLIVVNQDSLNTIPVILGTLRTDES
ITPNIFIAITLLAMLPSIIVYLGLQKHFNRGIMSGAVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory