Comparing BWI76_RS17950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P64512 PhoP/PhoQ regulator MgrB from Escherichia coli (strain K12) (see paper)
72% identity, 100% coverage: 1:47/47 of query aligns to 1:47/47 of P64512
>BWI76_RS17950
MKKLRWVLLTVIIAGCLLLWTQMLNVMCDQDVQFFSGICTINKFIPW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory