Comparing BWI76_RS18100 BWI76_RS18100 phosphogluconate dehydratase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 85% coverage: 56:566/603 of query aligns to 29:543/575 of P9WKJ5
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
30% identity, 85% coverage: 56:566/603 of query aligns to 16:530/562 of 6ovtA
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
29% identity, 83% coverage: 65:565/603 of query aligns to 44:531/579 of B5ZZ34
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
31% identity, 72% coverage: 145:576/603 of query aligns to 112:546/587 of 7m3kA
Sites not aligning to the query:
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
29% identity, 83% coverage: 65:565/603 of query aligns to 41:528/576 of 5j85A
8hs0A The mutant structure of dhad v178w
29% identity, 90% coverage: 23:566/603 of query aligns to 18:537/570 of 8hs0A
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 90% coverage: 23:566/603 of query aligns to 56:575/608 of Q9LIR4
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
33% identity, 73% coverage: 125:566/603 of query aligns to 89:521/568 of 8ej0A
Sites not aligning to the query:
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
33% identity, 73% coverage: 125:566/603 of query aligns to 90:522/569 of 8epzA
Sites not aligning to the query:
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
29% identity, 83% coverage: 65:565/603 of query aligns to 41:529/583 of Q1JUQ1
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
32% identity, 69% coverage: 154:570/603 of query aligns to 132:554/595 of Q9A9Z2
Sites not aligning to the query:
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
32% identity, 69% coverage: 154:570/603 of query aligns to 126:548/589 of 5oynA
Sites not aligning to the query:
>BWI76_RS18100 BWI76_RS18100 phosphogluconate dehydratase
MNSEMLRVTNRIIERSRDTREAYLARINQAKTDTVHRAQLACGNLAHGFAACQADDKASL
KSMLRNNIAIITSYNDMLSAHQPYERYPDIIRKALHSANAVGQVAGGVPAMCDGVTQGQD
GMELSLLSREVIAMSAAIGLSHNMFDGALYLGVCDKIVPGLAMAALSFGHLPSIFIPSGP
MASGLANKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTANTNQMVVEFMGMQ
LPGSSFVHPDAPLREALTAAAARQVTRLTGNGNEWMPLGKMFDEKVVVNGIVALLATGGS
TNHTMHLVAMARAAGIIINWDDFSDLSDVVPLLARLYPNGPADINHFQAAGGVPVLVREL
LKGGLLHEDVHTVAGFGLSRYTMEPWLNNGELDWREGAAAPLDEAVIATFDKPFSRHGGT
KVLSGNLGRAVMKTSAVPVENQIIEAPAVVFESQHDVLPAFEAGLLDKDCVVVVRHQGPK
ANGMPELHKLMPPLGVLLDRRFKIALVTDGRLSGASGKVPSAIHVTPEAYDGGLLAKVRD
GDIIRVNGQTGELTLRVDDAELAARQPHIPDLSGSRVGTGREMFGALREKLSGAEQGATC
ITF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory