SitesBLAST
Comparing BWI76_RS18245 FitnessBrowser__Koxy:BWI76_RS18245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 98% coverage: 8:501/504 of query aligns to 5:497/501 of P04983
- K43 (= K46) mutation to R: Loss of transport.
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 40% coverage: 23:222/504 of query aligns to 22:221/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 40% coverage: 23:222/504 of query aligns to 25:224/233 of P75957
- G42 (= G40) mutation to D: Loss of lipoprotein release when overexpressed.
7mdyC Lolcde nucleotide-bound
34% identity, 40% coverage: 23:222/504 of query aligns to 22:221/226 of 7mdyC
- binding adp orthovanadate: G42 (= G43), S43 (≠ A44), G44 (= G45), K45 (= K46), S46 (= S47), T47 (= T48), Q91 (= Q89), H138 (≠ T139), E142 (≠ Y143), S144 (= S145), G145 (≠ I146), G146 (= G147), E168 (= E169), N172 (≠ S173), H201 (= H201)
- binding magnesium ion: S46 (= S47), Q91 (= Q89)
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
33% identity, 40% coverage: 23:222/504 of query aligns to 24:223/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: S43 (≠ N42), G44 (= G43), G46 (= G45), K47 (= K46), S48 (= S47), T49 (= T48), Q93 (= Q89), R137 (≠ D136), H140 (≠ T139), E144 (≠ Y143), S146 (= S145), G148 (= G147), E149 (≠ Q148), H203 (= H201)
- binding magnesium ion: S48 (= S47), Q93 (= Q89)
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 49% coverage: 5:252/504 of query aligns to 2:248/648 of P75831
- K47 (= K46) mutation to L: Lack of activity.
- D169 (= D168) mutation to N: Lack of activity.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
32% identity, 43% coverage: 5:222/504 of query aligns to 2:219/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (= F17), V18 (= V20), A20 (= A22), N40 (= N42), G41 (= G43), G43 (= G45), K44 (= K46), S45 (= S47), T46 (= T48), Q88 (= Q89), H139 (≠ K142), M140 (≠ Y143), L141 (= L144), S142 (= S145), G144 (= G147), Q145 (= Q148), Q166 (≠ E169), H198 (= H201)
- binding magnesium ion: S45 (= S47), Q88 (= Q89)
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 40% coverage: 22:224/504 of query aligns to 15:209/348 of 3d31A
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 3:274/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 55% coverage: 8:284/504 of query aligns to 4:275/371 of P68187
- A85 (≠ H92) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K111) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L119) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ Y122) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A124) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ K129) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G147) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D168) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ A235) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ I248) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (≠ S276) mutation to G: Normal maltose transport but constitutive mal gene expression.
Sites not aligning to the query:
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 3:274/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F17), S37 (≠ N42), G38 (= G43), C39 (≠ A44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), Q81 (= Q89), R128 (≠ I135), A132 (≠ Y143), S134 (= S145), G136 (= G147), Q137 (= Q148), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S47), Q81 (= Q89)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 3:274/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F17), G38 (= G43), C39 (≠ A44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ I135), S134 (= S145), Q137 (= Q148)
- binding beryllium trifluoride ion: S37 (≠ N42), G38 (= G43), K41 (= K46), Q81 (= Q89), S134 (= S145), G136 (= G147), H191 (= H201)
- binding magnesium ion: S42 (= S47), Q81 (= Q89)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 3:274/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F17), V17 (≠ A22), G38 (= G43), C39 (≠ A44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ I135), A132 (≠ Y143), S134 (= S145), Q137 (= Q148)
- binding tetrafluoroaluminate ion: S37 (≠ N42), G38 (= G43), K41 (= K46), Q81 (= Q89), S134 (= S145), G135 (≠ I146), G136 (= G147), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S47), Q81 (= Q89)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 3:274/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F17), V17 (≠ A22), G38 (= G43), C39 (≠ A44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ I135), A132 (≠ Y143), S134 (= S145), Q137 (= Q148)
- binding magnesium ion: S42 (= S47), Q81 (= Q89)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
30% identity, 55% coverage: 8:284/504 of query aligns to 1:272/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F17), S35 (≠ N42), G36 (= G43), C37 (≠ A44), G38 (= G45), K39 (= K46), S40 (= S47), T41 (= T48), R126 (≠ I135), A130 (≠ Y143), S132 (= S145), G134 (= G147), Q135 (= Q148)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
33% identity, 40% coverage: 20:222/504 of query aligns to 20:221/615 of 5lilA
- binding adenosine-5'-triphosphate: V22 (≠ A22), S42 (≠ N42), G43 (= G43), G45 (= G45), K46 (= K46), S47 (= S47), T48 (= T48), Q92 (= Q89), K136 (≠ D136), Q143 (≠ Y143), S145 (= S145), G147 (= G147), Q148 (= Q148)
- binding magnesium ion: S47 (= S47), Q92 (= Q89)
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
33% identity, 40% coverage: 20:222/504 of query aligns to 20:221/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (≠ A22), S42 (≠ N42), G43 (= G43), G45 (= G45), K46 (= K46), S47 (= S47), T48 (= T48), Q92 (= Q89), K136 (≠ D136), Q143 (≠ Y143), S145 (= S145), G147 (= G147), Q148 (= Q148)
- binding magnesium ion: S47 (= S47), Q92 (= Q89)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 44% coverage: 10:231/504 of query aligns to 11:228/343 of P30750
- 40:46 (vs. 42:48, 86% identical) binding
- E166 (= E169) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 44% coverage: 10:231/504 of query aligns to 12:229/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F10), Q14 (≠ G12), I19 (≠ V20), S41 (≠ N42), G42 (= G43), A43 (= A44), G44 (= G45), K45 (= K46), S46 (= S47), T47 (= T48), N141 (≠ Y143), S143 (= S145), Q146 (= Q148), H200 (= H201)
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 44% coverage: 10:231/504 of query aligns to 12:229/344 of 3tuzC
Sites not aligning to the query:
Query Sequence
>BWI76_RS18245 FitnessBrowser__Koxy:BWI76_RS18245
MQQSTPYLSFHGITMTFPGVKALSDISFGCYAGQVHALMGENGAGKSTLLKILSGNYIPT
AGSLQIRGQQMTFNHTTEALNAGVAIIYQELHLIPEMTVAENIYLGQLPHKGGIVNRSLL
NYEAGLQLKHLGLDIDPETPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIE
NLFRVIRELRQEGRVIIYVSHRMEEIFALSDAITVFKDGRYVRTFDNMQEVNHDALVQAM
VGRELGNIYGWQPREYGKERLRLEQVKAPGVRQPVSLSVRSGEIVGLFGLVGAGRSELMK
GLFGGSRITGGQVYIDGEAIDIRKPAQAIQAGMMLCPEDRKAEGIIPVHSVRDNINISAR
RKHILAGCVINNAWEAQNADQHIKSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKV
ILLDEPTRGIDVGAKHEIYNVIYALAASGVAVVFASSDLPEVLGVADRIVVMREGEIAGE
LLHEHANEQQALSLAMPKVSQAVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory