Comparing BWI76_RS18935 FitnessBrowser__Koxy:BWI76_RS18935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9S5G5 Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 from Escherichia coli O157:H7 (see paper)
87% identity, 100% coverage: 1:355/355 of query aligns to 1:355/355 of Q9S5G5
2fpsB Crystal structure of the n-terminal domain of e.Coli hisb- apo ca model. (see paper)
82% identity, 46% coverage: 3:165/355 of query aligns to 1:163/163 of 2fpsB
2fpuB Crystal structure of the n-terminal domain of e.Coli hisb- complex with histidinol (see paper)
82% identity, 46% coverage: 3:165/355 of query aligns to 1:160/160 of 2fpuB
2fprA Crystal structure the n-terminal domain of e. Coli hisb. Apo mg model. (see paper)
80% identity, 46% coverage: 2:163/355 of query aligns to 1:156/156 of 2fprA
O23346 Imidazoleglycerol-phosphate dehydratase 2, chloroplastic; IGPD 2; Protein HISTIDINE BIOSYNTHESIS 5B; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
54% identity, 53% coverage: 167:355/355 of query aligns to 76:269/272 of O23346
Sites not aligning to the query:
P34047 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic; IGPD 1; Protein HISTIDINE BIOSYNTHESIS 5A; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
53% identity, 53% coverage: 167:355/355 of query aligns to 74:267/270 of P34047
5el9A A. Thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution (see paper)
54% identity, 53% coverage: 167:355/355 of query aligns to 3:196/199 of 5el9A
5ekwA A. Thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348 (see paper)
54% identity, 53% coverage: 167:353/355 of query aligns to 3:194/194 of 5ekwA
4qnkA The structure of wt a. Thaliana igpd2 in complex with mn2+ and phosphate (see paper)
55% identity, 49% coverage: 167:340/355 of query aligns to 3:178/185 of 4qnkA
4mu1A The structure of wt a. Thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution (see paper)
55% identity, 49% coverage: 167:340/355 of query aligns to 3:178/185 of 4mu1A
4mu0A The structure of wt a. Thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution (see paper)
55% identity, 49% coverage: 167:340/355 of query aligns to 3:178/185 of 4mu0A
7oj5A Cryo-em structure of medicago truncatula hisn5 protein
53% identity, 49% coverage: 167:340/355 of query aligns to 2:177/184 of 7oj5A
2f1dA X-ray structure of imidazoleglycerol-phosphate dehydratase (see paper)
53% identity, 49% coverage: 167:340/355 of query aligns to 2:177/183 of 2f1dA
4mu3A The form a structure of an e21q catalytic mutant of a. Thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution (see paper)
54% identity, 49% coverage: 167:340/355 of query aligns to 3:178/186 of 4mu3A
6fwhL Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
45% identity, 53% coverage: 167:355/355 of query aligns to 2:194/195 of 6fwhL
6fwhA Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
45% identity, 53% coverage: 167:355/355 of query aligns to 3:195/196 of 6fwhA
6ezmU Imidazoleglycerol-phosphate dehydratase from saccharomyces cerevisiae (see paper)
42% identity, 54% coverage: 166:355/355 of query aligns to 1:212/212 of 6ezmU
P06633 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 54% coverage: 166:355/355 of query aligns to 3:219/220 of P06633
P40374 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 53% coverage: 167:355/355 of query aligns to 2:216/216 of P40374
1rhyB Crystal structure of imidazole glycerol phosphate dehydratase (see paper)
45% identity, 50% coverage: 166:341/355 of query aligns to 2:177/180 of 1rhyB
>BWI76_RS18935 FitnessBrowser__Koxy:BWI76_RS18935
MTQKFLFIDRDGTLISEPPVDFQVDRFDKLAFEPQVIPALLKLQQEGYKLVMITNQDGLG
TASLPQDEFDGPHNLMMQIFASQGVNFDEVLICPHLPADNCDCRKPKTRLVLPWLEQGVM
DTAHSYVIGDRATDIQLADNMGITGLRYDREQLDWPTICEQLTRRDRYAHVERITKETQV
DVKVWLDREGGSKISTGVGFFDHMLDQIATHGGFRLEVNVGGDLYIDDHHTVEDTGLALG
EALKLALGDKRGIGRFGFVLPMDECLARCALDISGRPHLEYKADFTYQRVGDLSTEMVEH
FFRSLSYTMAVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVQGDTLPSSKGVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory