SitesBLAST
Comparing BWI76_RS18995 FitnessBrowser__Koxy:BWI76_RS18995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
81% identity, 100% coverage: 1:334/334 of query aligns to 2:321/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D60), L62 (= L61), L83 (= L82), A84 (= A83), A85 (= A84), A118 (= A124), Y145 (= Y151), K149 (= K155), F172 (= F178), F173 (= F179), T174 (= T180), V175 (= V181), R181 (= R187)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
77% identity, 100% coverage: 1:333/334 of query aligns to 2:304/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (= N32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (= D60), L62 (= L61), L83 (= L82), A84 (= A83), A85 (= A84), A123 (= A124), Y150 (= Y151), K154 (= K155), F177 (= F178), V180 (= V181), R186 (= R187), M189 (= M190)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
34% identity, 100% coverage: 1:333/334 of query aligns to 1:315/321 of 6zllA
- active site: T126 (≠ S126), S127 (= S127), S128 (= S128), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ M33), I35 (≠ N34), K43 (= K42), D62 (= D60), I63 (≠ L61), L81 (= L82), A82 (= A83), A83 (= A84), I124 (≠ A124), T126 (≠ S126), Y149 (= Y151), K153 (= K155), Y176 (≠ F178), V179 (= V181), R185 (= R187), M188 (= M190)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A86), V87 (= V88), R88 (= R89), T126 (≠ S126), S127 (= S127), Y149 (= Y151), T178 (= T180), R185 (= R187), A189 (= A191), R192 (≠ K194), T204 (≠ D206), F206 (≠ Y208), Q211 (≠ M213), R213 (= R215), I250 (≠ L268), E276 (≠ D294)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
34% identity, 99% coverage: 1:332/334 of query aligns to 1:314/314 of 6zldA
- active site: T126 (≠ S126), S127 (= S127), S128 (= S128), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ M33), I35 (≠ N34), K43 (= K42), D62 (= D60), I63 (≠ L61), L81 (= L82), A82 (= A83), A83 (= A84), I124 (≠ A124), T126 (≠ S126), K153 (= K155), Y176 (≠ F178), T178 (= T180), R185 (= R187), M188 (= M190)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A86), R88 (= R89), T126 (≠ S126), S127 (= S127), S128 (= S128), Y149 (= Y151), F177 (= F179), T178 (= T180), R185 (= R187), M188 (= M190), A189 (= A191), R192 (≠ K194), T204 (≠ D206), F206 (≠ Y208), Q211 (≠ M213), R213 (= R215), I250 (≠ L268), E276 (≠ D294)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
34% identity, 99% coverage: 1:332/334 of query aligns to 1:314/314 of 6zl6A
- active site: T126 (≠ S126), S127 (= S127), S128 (= S128), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ M33), I35 (≠ N34), K43 (= K42), D62 (= D60), I63 (≠ L61), L81 (= L82), A82 (= A83), A83 (= A84), I124 (≠ A124), T126 (≠ S126), K153 (= K155), Y176 (≠ F178), T178 (= T180), V179 (= V181), R185 (= R187), M188 (= M190)
- binding uridine-5'-diphosphate: T178 (= T180), A189 (= A191), R192 (≠ K194), T204 (≠ D206), F206 (≠ Y208), Q211 (≠ M213), R213 (= R215), I250 (≠ L268), E276 (≠ D294)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
34% identity, 99% coverage: 1:332/334 of query aligns to 1:314/314 of 6zljA
- active site: T126 (≠ S126), S127 (= S127), S128 (= S128), F149 (≠ Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ N32), F34 (≠ M33), I35 (≠ N34), K43 (= K42), D62 (= D60), I63 (≠ L61), L81 (= L82), A82 (= A83), A83 (= A84), I124 (≠ A124), T126 (≠ S126), K153 (= K155), Y176 (≠ F178), T178 (= T180), V179 (= V181), R185 (= R187), M188 (= M190)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A86), R88 (= R89), T126 (≠ S126), S127 (= S127), S128 (= S128), F149 (≠ Y151), F177 (= F179), T178 (= T180), R185 (= R187), M188 (= M190), A189 (= A191), R192 (≠ K194), T204 (≠ D206), F206 (≠ Y208), Q211 (≠ M213), R213 (= R215), I250 (≠ L268), E276 (≠ D294)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 99% coverage: 3:333/334 of query aligns to 19:336/336 of 3ruhA
- active site: S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), K170 (= K155), N204 (≠ D189)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D60), I79 (≠ L61), Q98 (≠ L82), A99 (= A83), A100 (= A84), T117 (≠ A101), A140 (= A124), A141 (≠ S125), S142 (= S126), Y166 (= Y151), K170 (= K155), Y193 (≠ F178), V196 (= V181)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A86), S103 (≠ G87), S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), Y193 (≠ F178), N195 (≠ T180), A209 (vs. gap), V210 (vs. gap), K213 (= K194), W214 (≠ F195), Y225 (≠ D206), I226 (≠ V207), N227 (≠ Y208), R234 (= R215), L271 (= L268), R294 (≠ Q291), D297 (= D294), V298 (= V295), S301 (≠ T298)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 99% coverage: 3:333/334 of query aligns to 19:336/336 of 3rufA
- active site: S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), K170 (= K155), N204 (≠ D189)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D60), I79 (≠ L61), Q98 (≠ L82), A99 (= A83), A100 (= A84), T117 (≠ A101), A140 (= A124), Y166 (= Y151), K170 (= K155), Y193 (≠ F178), V196 (= V181)
- binding uridine-5'-diphosphate: N195 (≠ T180), A209 (vs. gap), V210 (vs. gap), K213 (= K194), W214 (≠ F195), Y225 (≠ D206), I226 (≠ V207), N227 (≠ Y208), R234 (= R215), L271 (= L268), R294 (≠ Q291), D297 (= D294)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
29% identity, 99% coverage: 3:333/334 of query aligns to 19:336/336 of 3lu1A
- active site: S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), K170 (= K155), N204 (≠ D189)
- binding glycine: Q135 (≠ E119), K187 (≠ P172)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (= D60), I79 (≠ L61), Q98 (≠ L82), A99 (= A83), A100 (= A84), A140 (= A124), A141 (≠ S125), S142 (= S126), Y166 (= Y151), K170 (= K155), Y193 (≠ F178), N195 (≠ T180)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G87), S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), N195 (≠ T180), V210 (vs. gap), W214 (≠ F195), Y225 (≠ D206), I226 (≠ V207), N227 (≠ Y208), R234 (= R215), L271 (= L268), R294 (≠ Q291), D297 (= D294)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
29% identity, 99% coverage: 3:333/334 of query aligns to 22:344/345 of Q7BJX9
- GVAGFI 26:31 (≠ GAAGFI 7:12) binding
- DNFSTG 50:55 (≠ DNMNDY 31:36) binding
- DI 81:82 (≠ DL 60:61) binding
- QAA 101:103 (≠ LAA 82:84) binding
- T120 (≠ A101) binding
- SS 145:146 (= SS 126:127) binding
- S147 (= S128) mutation to T: No effect on epimerase activity.
- Y169 (= Y151) binding
- K173 (= K155) binding
- YFN 196:198 (≠ FFT 178:180) binding
- V199 (= V181) binding
- VIPK 213:216 (≠ -LFK 192:194) binding
- YIN 228:230 (≠ DVY 206:208) binding
- S236 (≠ K214) mutation to G: No effect on epimerase activity.
- R237 (= R215) binding
- R271 (≠ P265) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ -PGD 292:294) binding
- R307 (≠ L296) mutation to A: No effect on epimerase activity.
- H308 (≠ E297) mutation to A: No effect on epimerase activity.
- S309 (≠ T298) mutation to Y: Abolishes epimerase activity.
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
29% identity, 99% coverage: 1:329/334 of query aligns to 1:305/309 of 4zrnA
- active site: T117 (≠ S126), G119 (vs. gap), A120 (≠ S128), Y143 (= Y151), K147 (= K155), Y181 (≠ W185), G185 (≠ D189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), S34 (≠ N34), S35 (≠ D35), G36 (≠ Y36), S51 (≠ D60), I52 (≠ L61), L73 (= L82), A74 (= A83), A75 (= A84), T92 (≠ A101), S115 (≠ A124), S116 (= S125), Y143 (= Y151), K147 (= K155), Y170 (≠ F178), V173 (= V181)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S126), G119 (vs. gap), A120 (≠ S128), Y143 (= Y151), N172 (≠ T180), G185 (≠ D189), V186 (≠ M190), H201 (≠ D206), F203 (≠ Y208), Y208 (≠ M213), R210 (= R215), V244 (≠ L268), R267 (≠ Q291), D270 (= D294)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
30% identity, 99% coverage: 3:333/334 of query aligns to 18:340/340 of 1sb9A
- active site: S141 (= S126), S142 (= S127), S143 (= S128), Y165 (= Y151), K169 (= K155), N203 (≠ D189)
- binding nicotinamide-adenine-dinucleotide: G22 (= G7), G25 (= G10), F26 (= F11), I27 (= I12), D46 (= D31), N47 (= N32), F48 (≠ M33), T50 (≠ D35), G51 (≠ Y36), D77 (= D60), I78 (≠ L61), Q97 (≠ L82), A99 (= A84), T116 (≠ A101), A139 (= A124), A140 (≠ S125), Y165 (= Y151), K169 (= K155), Y192 (≠ F178), N194 (≠ T180), V195 (= V181)
- binding uridine-5'-diphosphate-glucose: S141 (= S126), Y165 (= Y151), N194 (≠ T180), A208 (vs. gap), V209 (vs. gap), W213 (≠ F195), Y224 (≠ D206), I225 (≠ V207), N226 (≠ Y208), L270 (= L268), R298 (≠ Q291), D301 (= D294)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
30% identity, 99% coverage: 3:333/334 of query aligns to 19:341/341 of 1sb8A
- active site: S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), K170 (= K155), N204 (≠ D189)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (= N32), F49 (≠ M33), T51 (≠ D35), G52 (≠ Y36), D78 (= D60), I79 (≠ L61), Q98 (≠ L82), A100 (= A84), T117 (≠ A101), A140 (= A124), A141 (≠ S125), Y166 (= Y151), K170 (= K155), Y193 (≠ F178), N195 (≠ T180), V196 (= V181)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G87), S142 (= S126), S143 (= S127), S144 (= S128), Y166 (= Y151), N195 (≠ T180), A209 (vs. gap), V210 (vs. gap), W214 (≠ F195), Y225 (≠ D206), I226 (≠ V207), N227 (≠ Y208), R234 (= R215), L271 (= L268), R299 (≠ Q291), D302 (= D294), S306 (≠ T298)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 98% coverage: 4:329/334 of query aligns to 4:296/299 of 6kv9A
- active site: S110 (= S126), S111 (= S127), S112 (= S128), Y133 (= Y151), K137 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), R32 (≠ N32), R33 (≠ M33), D47 (= D47), L48 (= L48), L66 (= L82), A67 (= A83), A68 (= A84), P70 (≠ A86), C85 (≠ A101), A108 (= A124), S109 (= S125), K137 (= K155), F162 (= F178), T164 (= T180), V165 (= V181), R171 (= R187), M174 (= M190)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ A86), R73 (= R89), S110 (= S126), S111 (= S127), Y133 (= Y151), T164 (= T180), R171 (= R187), M174 (= M190), F175 (≠ A191), R178 (≠ K194), E190 (≠ D206), I191 (≠ V207), Y192 (= Y208), Q197 (≠ M213), R199 (= R215), V235 (≠ L268), D261 (= D294)
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
31% identity, 98% coverage: 4:329/334 of query aligns to 4:295/299 of 6kvcA
- active site: S109 (= S126), S110 (= S127), S111 (= S128), Y132 (= Y151), K136 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), R32 (≠ N32), R33 (≠ N34), D46 (= D47), L47 (= L48), L65 (= L82), A66 (= A83), A67 (= A84), P69 (≠ A86), A107 (= A124), S109 (= S126), K136 (= K155), F161 (= F178), T163 (= T180), V164 (= V181), R170 (= R187), M173 (= M190)
- binding uridine-5'-diphosphate-glucose: P69 (≠ A86), R72 (= R89), S109 (= S126), S110 (= S127), Y132 (= Y151), T163 (= T180), M173 (= M190), F174 (≠ A191), R177 (≠ K194), E189 (≠ D206), I190 (≠ V207), Y191 (= Y208), Q196 (≠ M213), R198 (= R215), D260 (= D294)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
31% identity, 99% coverage: 1:330/334 of query aligns to 1:309/311 of 2p5uA
- active site: T117 (≠ S126), G119 (≠ S127), A120 (≠ S128), Y143 (= Y151), K147 (= K155), H181 (≠ D189), G185 (≠ M190)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ M33), A34 (≠ N34), T35 (≠ D35), G36 (≠ Y36), D51 (= D60), L52 (= L61), Q73 (≠ L82), A74 (= A83), A75 (= A84), A77 (= A86), S116 (= S125), Y143 (= Y151), K147 (= K155), V173 (= V181)
3aw9A Structure of udp-galactose 4-epimerase mutant
29% identity, 97% coverage: 1:323/334 of query aligns to 1:295/304 of 3aw9A
- active site: A105 (= A124), S107 (= S126), S108 (= S127), T109 (≠ S128), Y131 (= Y151), K135 (= K155), L166 (≠ G186), G169 (≠ D189)
- binding galactose-uridine-5'-diphosphate: P69 (≠ A86), V71 (= V88), S107 (= S126), Y131 (= Y151), N160 (≠ T180), H168 (≠ P188), V170 (≠ M190), D173 (≠ F193), L188 (≠ Y208), Q193 (≠ M213), K195 (≠ R215), Y197 (≠ F217), V234 (≠ L268), W263 (vs. gap), D266 (= D294)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), I32 (≠ N32), R46 (≠ I59), D47 (= D60), L48 (= L61), F65 (≠ L82), A66 (= A83), A67 (= A84), E82 (≠ A101), A105 (= A124), S106 (= S125), Y131 (= Y151), K135 (= K155), Y158 (≠ F178), N160 (≠ T180), V161 (= V181), H168 (≠ P188)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 99% coverage: 2:330/334 of query aligns to 3:333/355 of P27830
- FI 12:13 (= FI 11:12) binding
- DKLT 33:36 (≠ DNMN 31:34) binding
- DI 59:60 (≠ DL 60:61) binding
- T100 (≠ A101) binding
- D135 (≠ S127) active site, Proton donor
- E136 (≠ S128) active site, Proton acceptor
- Y160 (= Y151) active site, Proton acceptor
- YSASK 160:164 (≠ YAATK 151:155) binding
- N190 (≠ V181) binding
3vpsA Structure of a novel NAD dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis
28% identity, 99% coverage: 2:330/334 of query aligns to 3:298/303 of 3vpsA
- active site: T113 (≠ S126), C114 (≠ S127), E115 (≠ S128), Y137 (= Y151), K141 (= K155), D176 (= D189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), D33 (≠ N32), R35 (≠ N34), V36 (≠ Y36), P52 (= P52), V53 (≠ L53), L70 (= L82), A71 (= A83), S72 (≠ A84), K74 (≠ A86), T113 (≠ S126), K141 (= K155), F165 (= F178), V168 (= V181)
- binding uridine-diphosphate-n-acetylglucosamine: K74 (≠ A86), T113 (≠ S126), C114 (≠ S127), E115 (≠ S128), Y137 (= Y151), N167 (≠ T180), D176 (= D189), A177 (≠ M190), L178 (≠ A191), R181 (≠ K194), P193 (≠ D206), V194 (= V207), E195 (≠ Y208), Q200 (≠ M213), R202 (= R215), V236 (≠ L268), R258 (≠ Q291), E261 (≠ D294)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
33% identity, 68% coverage: 1:228/334 of query aligns to 1:227/313 of 6bwlA
- active site: T122 (≠ S126), C123 (≠ S127), M124 (≠ S128), Y147 (= Y151), K151 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ M33), N35 (≠ D35), S36 (≠ Y36), D57 (= D60), I58 (≠ L61), L79 (= L82), A80 (= A83), A81 (= A84), I83 (≠ A86), M120 (≠ A124), K151 (= K155), N176 (≠ T180), T177 (≠ V181)
- binding uridine-5'-diphosphate: N176 (≠ T180), G189 (≠ M190), V190 (≠ A191), N205 (≠ D206), I206 (≠ V207), Y207 (= Y208), Q212 (≠ M213), R214 (= R215)
Sites not aligning to the query:
Query Sequence
>BWI76_RS18995 FitnessBrowser__Koxy:BWI76_RS18995
MKFLVTGAAGFIGFHTCKRLLEAGHEVVGLDNMNDYYDVNLKQARLDLLQSPLFSFHKID
LADREGIARLFANEKFNRVIHLAAQAGVRYSLENPFAYADANLIGYLNILEGCRHNNVEH
LLYASSSSVYGLNRKMPFSTDDSVDHPVSLYAATKKANELMAHTYSHLYGIPTTGLRFFT
VYGPWGRPDMALFKFTKAMLEGKPIDVYNYGKMKRDFTYIDDIVEAIVRMQDIIPQPNPE
WTVETGSPADSSAPYRVYNIGNSSPVELMDYITALEEAMGMVAEKNMMPIQPGDVLETSA
DTKPLYDAVGFRPQTTVRQGVKNFVDWYKAYYKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory