SitesBLAST
Comparing BWI76_RS19065 FitnessBrowser__Koxy:BWI76_RS19065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
79% identity, 99% coverage: 2:352/354 of query aligns to 3:353/355 of P27830
- FI 12:13 (= FI 11:12) binding NAD(+)
- DKLT 33:36 (≠ DCLT 32:35) binding NAD(+)
- DI 59:60 (≠ NI 58:59) binding NAD(+)
- T100 (= T99) binding NAD(+)
- D135 (= D134) active site, Proton donor
- E136 (= E135) active site, Proton acceptor
- Y160 (= Y159) active site, Proton acceptor
- YSASK 160:164 (= YSASK 159:163) binding NAD(+)
- N190 (= N189) binding NAD(+)
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
77% identity, 98% coverage: 2:349/354 of query aligns to 3:344/344 of 1bxkB
- active site: S125 (= S124), T134 (= T133), D135 (= D134), E136 (= E135), S158 (= S157), Y160 (= Y159), S161 (= S160), K164 (= K163)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D33 (= D32), K34 (≠ C33), L35 (= L34), T36 (= T35), A38 (= A37), G39 (= G38), D59 (≠ N58), I60 (= I59), L81 (= L80), A83 (= A82), T100 (= T99), I132 (= I131), S133 (= S132), T134 (= T133), K164 (= K163), C187 (= C186)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
75% identity, 97% coverage: 1:345/354 of query aligns to 1:349/361 of 1kewA
- active site: T133 (= T133), D134 (= D134), E135 (= E135), L152 (vs. gap), L154 (= L146), F155 (= F147), T158 (≠ K150), Y167 (= Y159), K171 (= K163)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D32), K33 (≠ C33), L34 (= L34), T35 (= T35), A37 (= A37), G38 (= G38), D58 (≠ N58), I59 (= I59), L80 (= L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), I131 (= I131), S132 (= S132), T133 (= T133), Y167 (= Y159), K171 (= K163), C194 (= C186), N196 (= N188), N197 (= N189)
- binding thymidine-5'-diphosphate: E135 (= E135), N196 (= N188), K206 (= K198), L207 (= L199), P222 (= P214), Y224 (= Y216), R231 (= R223), N266 (= N258), R297 (= R293), H300 (= H296)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
75% identity, 97% coverage: 1:345/354 of query aligns to 1:349/361 of 1keuA
- active site: T133 (= T133), D134 (= D134), E135 (= E135), L152 (vs. gap), L154 (= L146), F155 (= F147), T158 (≠ K150), Y167 (= Y159), K171 (= K163)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S84), T133 (= T133), D134 (= D134), E135 (= E135), Y167 (= Y159), N196 (= N188), K206 (= K198), L207 (= L199), P222 (= P214), Y224 (= Y216), R231 (= R223), N266 (= N258), R297 (= R293), H300 (= H296)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D32), K33 (≠ C33), L34 (= L34), T35 (= T35), G38 (= G38), D58 (≠ N58), L80 (= L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), S132 (= S132), T133 (= T133), Y167 (= Y159), K171 (= K163), C194 (= C186), N196 (= N188), N197 (= N189)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
75% identity, 97% coverage: 1:345/354 of query aligns to 1:349/361 of P26391
Sites not aligning to the query:
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
56% identity, 97% coverage: 3:345/354 of query aligns to 6:352/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D32), A37 (≠ C33), L38 (= L34), T39 (= T35), G42 (= G38), D62 (≠ N58), I63 (= I59), L84 (= L80), A85 (= A81), A86 (= A82), T103 (= T99), S143 (= S132), T144 (= T133), Y169 (= Y159), K173 (= K163), C196 (= C186)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
47% identity, 97% coverage: 1:342/354 of query aligns to 2:318/329 of 2hunA
- active site: T125 (= T133), D126 (= D134), E127 (= E135), Y149 (= Y159), K153 (= K163)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), K35 (≠ C33), S40 (≠ G38), D60 (≠ N58), V61 (≠ I59), L80 (= L80), A81 (= A81), A82 (= A82), S99 (≠ T99), T125 (= T133), K153 (= K163), C176 (= C186), T177 (≠ S187), N178 (= N188), N179 (= N189)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
45% identity, 96% coverage: 3:343/354 of query aligns to 6:334/347 of 1kerB
- active site: T124 (= T133), D125 (= D134), E126 (= E135), Y160 (= Y159), K164 (= K163)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S84), N87 (≠ V86), T124 (= T133), D125 (= D134), E126 (= E135), Y160 (= Y159), N189 (= N188), K199 (= K198), F200 (≠ L199), R203 (≠ L202), Q204 (≠ I203), K215 (≠ P214), L216 (≠ V215), Y217 (= Y216), R224 (= R223), N259 (= N258), R283 (= R293), H286 (= H296)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D32), K37 (≠ C33), L38 (= L34), T39 (= T35), G42 (= G38), D61 (≠ N58), I62 (= I59), Y81 (≠ L80), A82 (= A81), A83 (= A82), S85 (= S84), T100 (= T99), S123 (= S132), T124 (= T133), Y160 (= Y159), K164 (= K163), C187 (= C186), N190 (= N189)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
45% identity, 96% coverage: 3:343/354 of query aligns to 5:333/346 of 1ketA
- active site: T123 (= T133), D124 (= D134), E125 (= E135), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D32), K36 (≠ C33), L37 (= L34), T38 (= T35), A40 (= A37), G41 (= G38), D60 (≠ N58), I61 (= I59), Y80 (≠ L80), A82 (= A82), S84 (= S84), T99 (= T99), S122 (= S132), T123 (= T133), Y159 (= Y159), K163 (= K163)
- binding thymidine-5'-diphosphate: E125 (= E135), N188 (= N188), F199 (≠ L199), R202 (≠ L202), Q203 (≠ I203), K214 (≠ P214), Y216 (= Y216), R223 (= R223), N258 (= N258), R282 (= R293), H285 (= H296)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
45% identity, 96% coverage: 3:343/354 of query aligns to 5:333/346 of 1kepA
- active site: T123 (= T133), D124 (= D134), E125 (= E135), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D32), K36 (≠ C33), L37 (= L34), T38 (= T35), G41 (= G38), D60 (≠ N58), I61 (= I59), Y80 (≠ L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), S122 (= S132), Y159 (= Y159), K163 (= K163), N189 (= N189)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S84), T123 (= T133), E125 (= E135), Y159 (= Y159), N188 (= N188), K198 (= K198), R223 (= R223), R282 (= R293)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
46% identity, 96% coverage: 3:343/354 of query aligns to 7:335/348 of P95780
- FI 15:16 (= FI 11:12) binding NAD(+)
- DKLT 37:40 (≠ DCLT 32:35) binding NAD(+)
- DI 62:63 (≠ NI 58:59) binding NAD(+)
- YAAES 82:86 (≠ LAAES 80:84) binding NAD(+)
- N88 (≠ V86) binding substrate
- T101 (= T99) binding NAD(+)
- T125 (= T133) binding substrate
- N190 (= N188) binding substrate
- N191 (= N189) binding NAD(+)
- KFIPRQ 200:205 (≠ KLIPLI 198:203) binding substrate
- KLY 216:218 (≠ PVY 214:216) binding substrate
- R225 (= R223) binding substrate
- N260 (= N258) binding substrate
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
45% identity, 96% coverage: 1:341/354 of query aligns to 2:311/311 of 6bi4C
- active site: T117 (= T133), D118 (= D134), E119 (= E135), Y142 (= Y159), K146 (= K163)
- binding beta-D-fructofuranose: Q62 (≠ C60), N63 (≠ D61), G64 (≠ K62), E65 (≠ D63)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), A35 (≠ C33), L36 (= L34), T37 (= T35), S39 (≠ A37), G40 (= G38), E60 (≠ N58), I61 (= I59), Q62 (≠ C60), F82 (≠ L80), A83 (= A81), A84 (= A82), T92 (= T99), V115 (≠ I131), T117 (= T133), Y142 (= Y159), K146 (= K163), C169 (= C186), S170 (= S187)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
45% identity, 96% coverage: 1:341/354 of query aligns to 2:310/310 of 6bi4B
- active site: T117 (= T133), D118 (= D134), E119 (= E135), Y142 (= Y159), K146 (= K163)
- binding alpha-D-glucopyranose: Q62 (≠ C60), N63 (≠ D61)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), A35 (≠ C33), L36 (= L34), T37 (= T35), S39 (≠ A37), G40 (= G38), E60 (≠ N58), F82 (≠ L80), A83 (= A81), A84 (= A82), T92 (= T99), S116 (= S132), T117 (= T133), Y142 (= Y159), K146 (= K163), C169 (= C186)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
44% identity, 96% coverage: 1:341/354 of query aligns to 1:322/322 of 1r66A
- active site: T127 (= T133), D128 (= D134), E129 (= E135), Y151 (= Y159), K155 (= K163)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D32), S38 (≠ C33), L39 (= L34), T40 (= T35), G43 (= G38), D63 (≠ N58), I64 (= I59), F83 (≠ L80), A84 (= A81), A85 (= A82), S87 (= S84), T102 (= T99), V125 (≠ I131), S126 (= S132), Y151 (= Y159), K155 (= K163), N181 (= N189)
- binding thymidine-5'-diphosphate: H88 (= H85), E129 (= E135), N180 (= N188), K190 (= K198), L191 (= L199), P206 (= P214), Y208 (= Y216), R215 (= R223), N250 (= N258), R274 (= R293), H277 (= H296)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
43% identity, 96% coverage: 1:341/354 of query aligns to 1:322/322 of 1r6dA
- active site: T127 (= T133), N128 (≠ D134), Q129 (≠ E135), Y151 (= Y159), K155 (= K163)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S84), H88 (= H85), T127 (= T133), N128 (≠ D134), Q129 (≠ E135), Y151 (= Y159), N180 (= N188), K190 (= K198), L191 (= L199), P206 (= P214), Y208 (= Y216), R215 (= R223), N250 (= N258), R274 (= R293), H277 (= H296), Y281 (= Y300)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D32), S38 (≠ C33), L39 (= L34), T40 (= T35), A42 (= A37), G43 (= G38), D63 (≠ N58), I64 (= I59), F83 (≠ L80), A84 (= A81), A85 (= A82), S87 (= S84), T102 (= T99), V125 (≠ I131), S126 (= S132), Y151 (= Y159), K155 (= K163), N181 (= N189)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 95% coverage: 3:340/354 of query aligns to 11:331/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ E27) mutation to A: Reduces dehydratase activity.
- D96 (= D87) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K163) mutation to A: Abolishes dehydratase activity.
- G193 (= G191) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
39% identity, 96% coverage: 2:341/354 of query aligns to 9:326/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), F18 (= F11), I19 (= I12), D44 (= D32), S45 (≠ C33), L46 (= L34), T47 (= T35), G50 (= G38), D68 (≠ N58), I69 (= I59), F88 (≠ L80), A89 (= A81), A90 (= A82), T92 (≠ S84), T107 (= T99), V130 (≠ I131), Y156 (= Y159), K160 (= K163), G184 (≠ S187), N186 (= N189)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
39% identity, 96% coverage: 2:341/354 of query aligns to 8:325/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G10), F17 (= F11), I18 (= I12), D43 (= D32), S44 (≠ C33), L45 (= L34), T46 (= T35), G49 (= G38), D67 (≠ N58), F87 (≠ L80), A88 (= A81), A89 (= A82), T91 (≠ S84), T106 (= T99), V129 (≠ I131), S130 (= S132), T131 (= T133), Y155 (= Y159), K159 (= K163)
- binding thymidine-5'-diphosphate: E133 (= E135), N184 (= N188), K194 (= K198), V195 (≠ L199), P210 (= P214), Y212 (= Y216), R219 (= R223), N254 (= N258), R278 (= R293), H281 (= H296)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 98% coverage: 3:350/354 of query aligns to 9:339/669 of Q9SYM5
- R283 (= R293) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
37% identity, 94% coverage: 3:333/354 of query aligns to 6:315/319 of 6vloA
- active site: T126 (= T133), D127 (= D134), E128 (= E135), Y151 (= Y159), K155 (= K163)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D32), I37 (≠ C33), A42 (≠ G38), D59 (≠ N58), I60 (= I59), F81 (≠ L80), A82 (= A81), A83 (= A82), S85 (= S84), M124 (≠ I131), T126 (= T133), K155 (= K163)
- binding thymidine-5'-diphosphate: N180 (= N188), K190 (= K198), L191 (= L199), K194 (≠ L202), H206 (≠ P214), Q208 (≠ Y216), R215 (= R223), V250 (≠ N258), R275 (= R293), R281 (= R299)
Query Sequence
>BWI76_RS19065 FitnessBrowser__Koxy:BWI76_RS19065
MKILVTGGAGFIGSAVVRHIINDTTDEVVVVDCLTYAGNLESLTQVSVSDRFSFEKVNIC
DKDELNRIFHYHKPDAVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEVARAYWNQLEE
QFKSNFRFHHISTDEVYGDLHGTDDLFTEKTSYSPSSPYSASKASSDHLVRAWLRTYGLP
TIVTNCSNNYGPFHFPEKLIPLIILNALEGKPLPVYGDGGQIRDWLYVEDHARALYKVVT
EGIVGETYNIGGHNERKNIDVVKTICLLLEEYVPTKPKGLNNYCDLITYVKDRPGHDVRY
AIDATKILNELGWKPQETFESGIRKTVEWYLANEIWWSRVKDGSYTDKRLGLSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory