Comparing BWI76_RS19105 FitnessBrowser__Koxy:BWI76_RS19105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
44% identity, 97% coverage: 7:296/298 of query aligns to 4:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
44% identity, 97% coverage: 7:296/298 of query aligns to 4:289/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
43% identity, 97% coverage: 7:296/298 of query aligns to 4:284/285 of 6ikzB
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
46% identity, 95% coverage: 7:289/298 of query aligns to 7:281/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
44% identity, 95% coverage: 7:289/298 of query aligns to 5:275/282 of 5ve7A
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
41% identity, 92% coverage: 7:280/298 of query aligns to 7:270/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
39% identity, 90% coverage: 7:274/298 of query aligns to 10:270/281 of 8f73E
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
36% identity, 92% coverage: 7:280/298 of query aligns to 7:237/255 of 2ux8A
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
37% identity, 91% coverage: 7:278/298 of query aligns to 4:260/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
37% identity, 91% coverage: 7:278/298 of query aligns to 4:260/265 of 3jukA
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
34% identity, 95% coverage: 8:290/298 of query aligns to 5:281/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
33% identity, 95% coverage: 8:290/298 of query aligns to 5:276/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
34% identity, 97% coverage: 9:298/298 of query aligns to 7:291/299 of 2pa4B
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
23% identity, 85% coverage: 7:258/298 of query aligns to 5:218/295 of 6n0uA
1lvwA Crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp
23% identity, 97% coverage: 6:295/298 of query aligns to 4:245/295 of 1lvwA
Sites not aligning to the query:
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
24% identity, 92% coverage: 6:278/298 of query aligns to 1:232/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
24% identity, 92% coverage: 6:278/298 of query aligns to 1:232/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
24% identity, 92% coverage: 6:278/298 of query aligns to 1:232/360 of 7d72E
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
23% identity, 80% coverage: 6:242/298 of query aligns to 1:199/294 of 4ho9A
Sites not aligning to the query:
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
23% identity, 80% coverage: 6:242/298 of query aligns to 1:199/289 of 4ho4A
Sites not aligning to the query:
>BWI76_RS19105 FitnessBrowser__Koxy:BWI76_RS19105
MKMVSLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMVQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQGQQLGLGHSILCAR
PLIGDNPFVVVLPDIILDDASADPLRYNLAAMVARFNETGRSQVLAKRMEGDLSEYSVIQ
TKDPLESAGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADVWSELERTEPGAWGRIQL
TDAIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVSYGLRNHKEGAKFRESIKKLLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory