SitesBLAST
Comparing BWI76_RS19175 BWI76_RS19175 dicarboxylate/amino acid:cation symporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
32% identity, 95% coverage: 11:413/424 of query aligns to 16:424/425 of O59010
- S65 (≠ T63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S271) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 271:273) binding
- M311 (≠ L306) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S309) binding
- V355 (= V350) binding
- D394 (= D383) binding
- M395 (= M384) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R386) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N390) binding
- D405 (≠ N394) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
32% identity, 95% coverage: 5:405/424 of query aligns to 5:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 95% coverage: 5:408/424 of query aligns to 14:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ W37), F46 (≠ W37), P75 (≠ T74), L91 (≠ T90), F95 (≠ L94), L130 (= L132), I133 (≠ F135), I159 (≠ M161), Y167 (≠ S169), K196 (= K191), G200 (≠ Y195), I207 (≠ L202), F210 (= F205), L250 (= L249), I262 (≠ L257), M269 (≠ V264), T334 (≠ S329), V335 (≠ F330), G336 (≠ S331), T340 (≠ V335), L343 (= L338), M399 (≠ A388)
- binding aspartic acid: S277 (= S272), S278 (= S273), T314 (≠ S309), G354 (= G349), A358 (≠ S353), G359 (≠ A354), D394 (= D383), R397 (= R386), T398 (≠ S387)
- binding sodium ion: Y89 (≠ F88), T92 (≠ S91), S93 (= S92), G306 (= G301), T308 (≠ S303), N310 (= N305), N310 (= N305), M311 (≠ L306), D312 (≠ V307), S349 (= S344), I350 (≠ K345), T352 (≠ I347), N401 (= N390), V402 (= V391), D405 (≠ N394)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
32% identity, 93% coverage: 11:406/424 of query aligns to 8:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
31% identity, 95% coverage: 5:405/424 of query aligns to 11:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ M85), I157 (≠ F162), Y164 (≠ S169), K193 (= K191), T305 (≠ S303), I306 (≠ F304), I347 (≠ K345)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L7), M199 (= M197), S275 (= S273), T311 (≠ S309), G356 (≠ A354), L384 (≠ M376), D391 (= D383), R394 (= R386)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 93% coverage: 11:405/424 of query aligns to 8:408/408 of 6bauA
- binding cysteine: S270 (= S273), M303 (≠ L306), T306 (≠ S309), A345 (= A348), G346 (= G349), V347 (= V350), G351 (≠ A354), D386 (= D383), C389 (≠ R386), T390 (≠ S387), N393 (= N390)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 96% coverage: 6:411/424 of query aligns to 6:411/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S271), S265 (= S273), M299 (≠ L306), T302 (≠ S309), T340 (≠ I347), G342 (= G349), V343 (= V350), G347 (≠ A354), D383 (= D383), R386 (= R386), T387 (≠ S387), N390 (= N390)
- binding decyl-beta-d-maltopyranoside: H23 (≠ A23), V212 (≠ L220), A216 (= A224)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 96% coverage: 6:411/424 of query aligns to 11:420/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 96% coverage: 6:411/424 of query aligns to 10:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K191), G195 (≠ Y195), R282 (= R283)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S271), S272 (= S272), S273 (= S273), M307 (≠ L306), T310 (≠ S309), G353 (≠ R352), A354 (≠ S353), R394 (= R386), T395 (≠ S387)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 96% coverage: 6:411/424 of query aligns to 13:422/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 96% coverage: 6:411/424 of query aligns to 13:422/427 of 5e9sA
- binding aspartic acid: R274 (≠ S271), S275 (= S272), S276 (= S273), T313 (≠ S309), G353 (= G349), V354 (= V350), A357 (≠ S353), G358 (≠ A354), D394 (= D383), R397 (= R386), T398 (≠ S387)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K191), G198 (≠ Y195), Y202 (≠ V199)
- binding sodium ion: Y87 (≠ F88), T90 (≠ S91), S91 (= S92), S276 (= S273), G305 (= G301), A306 (≠ Y302), T307 (≠ S303), N309 (= N305), N309 (= N305), M310 (≠ L306), D311 (≠ V307), S348 (= S344), I349 (≠ K345), G350 (= G346), T351 (≠ I347), N401 (= N390), V402 (= V391), D405 (≠ N394)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
30% identity, 93% coverage: 11:405/424 of query aligns to 8:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 86% coverage: 46:410/424 of query aligns to 58:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ T76), G89 (= G78), G92 (= G81), A95 (= A84), V96 (≠ M85), Y99 (≠ F88), M163 (= M161), F167 (≠ I165), F293 (= F296), V297 (≠ I300)
- binding aspartic acid: S268 (= S272), S269 (= S273), T306 (≠ S309), G346 (= G349), I347 (≠ V350), A350 (≠ S353), G351 (≠ A354), D380 (= D383), R383 (= R386), T384 (≠ S387)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 86% coverage: 46:410/424 of query aligns to 50:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ T76), G81 (= G78), G84 (= G81), Y91 (≠ F88), M156 (= M161), F160 (≠ I165), F286 (= F296), V290 (≠ I300)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (= I153), S262 (= S273), S263 (≠ E274), A292 (≠ Y302), T293 (≠ S303), M296 (≠ L306), T299 (≠ S309), G329 (= G346), A336 (≠ S353), G337 (≠ A354), D366 (= D383), R369 (= R386), N373 (= N390)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 85% coverage: 46:405/424 of query aligns to 48:417/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S272), S281 (= S273), T318 (≠ S309), G363 (≠ A354), M367 (≠ L358), V385 (≠ M376), D388 (= D379), R395 (= R386), T396 (≠ S387)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ H380)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (≠ K83), I95 (≠ L94), I252 (≠ V244)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 85% coverage: 46:405/424 of query aligns to 47:418/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
28% identity, 85% coverage: 46:405/424 of query aligns to 40:402/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T63), L58 (= L64), L65 (= L71), V339 (≠ K345), G340 (= G346), S343 (≠ G349), I344 (≠ V350)
- binding cholesterol: W188 (≠ Y198), I227 (≠ A239), F250 (≠ L257), W257 (≠ V264), M379 (≠ G385), S382 (≠ A388)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S273), M300 (≠ L306), T303 (≠ S309), Y306 (= Y312), G348 (≠ A354), L349 (= L355), M352 (≠ L358), I366 (= I372), L369 (= L375), V370 (≠ M376), D373 (= D379), D377 (= D383), R380 (= R386), T381 (≠ S387), N384 (= N390)
Sites not aligning to the query:
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
26% identity, 95% coverage: 5:405/424 of query aligns to 48:501/543 of P56564
- N206 (= N151) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
27% identity, 85% coverage: 46:405/424 of query aligns to 86:501/542 of P43003
- S363 (= S271) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (= SSS 271:273) binding
- T396 (≠ S303) binding
- T402 (≠ S309) binding
- IPQAG 443:447 (≠ VPRSA 350:354) binding
- D476 (= D383) binding
- R477 (≠ M384) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N390) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
27% identity, 87% coverage: 46:412/424 of query aligns to 83:513/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>BWI76_RS19175 BWI76_RS19175 dicarboxylate/amino acid:cation symporter
MASANKLTLFIVIFMLLGILSGAAIHAYAGQTTITAWSENITLLTDVFLRLIKMVIAPLV
FSTLTVGIMRLGETATIGRVGGKAMVWFITSSILSILVGLVIVTLEHPGAGLNLAIPKES
VDTGLAVSGMSLKGFLTHTIPTSITEAMASNEILQIVVFSMFFGIAGASLGEKFNAPLVA
ALNVVSHIMLKVTGYVMYVAPLAIFAAISSVIASQGLGILLNYASFIGGYYVAILLTSAV
LLAVGYMVLKKEVFRLLNMLKDPVLVAFTTSSSEAAYPKTLERLVEFGCSRNIASFVLPI
GYSFNLVGSMVYCSFAAMFIAQAYNVQLSFSEITVMMLTLMLASKGIAGVPRSALVVLAA
TIPSFNIPVAGILLLMGIDHFLDMGRSAINVLGNGIATAMLSKNEGQLQEEVLEAEAAPQ
QAEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory