Comparing BWI76_RS19240 FitnessBrowser__Koxy:BWI76_RS19240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
47% identity, 90% coverage: 25:256/257 of query aligns to 2:234/235 of 5owfA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
45% identity, 99% coverage: 3:256/257 of query aligns to 6:259/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
47% identity, 90% coverage: 25:256/257 of query aligns to 5:237/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
47% identity, 90% coverage: 25:256/257 of query aligns to 5:237/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
47% identity, 90% coverage: 25:256/257 of query aligns to 5:237/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
47% identity, 90% coverage: 25:256/257 of query aligns to 5:237/238 of 1lafE
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
46% identity, 90% coverage: 26:256/257 of query aligns to 28:259/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
46% identity, 90% coverage: 26:256/257 of query aligns to 6:237/238 of 1hslA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
45% identity, 90% coverage: 26:256/257 of query aligns to 28:259/260 of P0AEU0
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
39% identity, 88% coverage: 24:250/257 of query aligns to 2:225/225 of 3tqlA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
38% identity, 88% coverage: 25:250/257 of query aligns to 5:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
38% identity, 88% coverage: 25:250/257 of query aligns to 5:223/225 of 4zv2A
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
36% identity, 90% coverage: 26:257/257 of query aligns to 15:237/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
36% identity, 90% coverage: 26:257/257 of query aligns to 19:241/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
36% identity, 90% coverage: 26:257/257 of query aligns to 19:241/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
36% identity, 90% coverage: 26:257/257 of query aligns to 19:241/241 of 3vvdA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
33% identity, 88% coverage: 25:251/257 of query aligns to 7:228/228 of 2y7iA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
34% identity, 90% coverage: 22:253/257 of query aligns to 6:264/267 of 8hqrA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
30% identity, 90% coverage: 23:253/257 of query aligns to 2:252/259 of 5ovzA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
30% identity, 90% coverage: 23:253/257 of query aligns to 1:251/254 of 5otaA
>BWI76_RS19240 FitnessBrowser__Koxy:BWI76_RS19240
MKIRLAALLACMALSAPLAAQQFDTISFGVDGGYPPFDVLAPSGEITGFDIDIANALCTQ
LKAKCVFVKQPFESMIAALNAHKFDAIIASLNITDERKKEVDFTDRYYRSAAQLVARKGS
PLLPDAASLKGKTVGVQTGSTHEAFAKANWANHGVKIVGYANQDNVYLDLLSGRIDAALQ
DNIQAATGFIDTPRGQKFAFAGPVIQDGGISSDVGIAVNKDNPALRDALNGAIKAIRADG
TYDAIQKKYFSFDIYGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory