SitesBLAST
Comparing BWI76_RS19325 FitnessBrowser__Koxy:BWI76_RS19325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hclA Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
65% identity, 99% coverage: 1:381/384 of query aligns to 3:383/384 of 4hclA
- active site: S138 (= S136), K171 (= K169), H173 (= H171), P183 (= P181), D208 (= D206), F210 (≠ Y208), E234 (= E232), P259 (= P257), E260 (= E258), R282 (= R280), G284 (= G282), H311 (= H309), G312 (= G310), N313 (= N311), E331 (= E329), G333 (= G331), E340 (≠ D338)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: H26 (= H24), C141 (= C139), K171 (= K169), H173 (= H171), D208 (= D206), H211 (= H209), E260 (= E258), H311 (= H309), E331 (= E329)
- binding magnesium ion: D208 (= D206), E234 (= E232), S249 (≠ A247), L252 (= L250), E260 (= E258)
4hcdA Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
65% identity, 99% coverage: 1:381/384 of query aligns to 3:383/384 of 4hcdA
- active site: S138 (= S136), K171 (= K169), H173 (= H171), P183 (= P181), D208 (= D206), F210 (≠ Y208), E234 (= E232), P259 (= P257), E260 (= E258), R282 (= R280), G284 (= G282), H311 (= H309), G312 (= G310), N313 (= N311), E331 (= E329), G333 (= G331), E340 (≠ D338)
- binding magnesium ion: D208 (= D206), E234 (= E232), S249 (≠ A247), L252 (= L250), E260 (= E258), H345 (≠ A343), L348 (= L346)
4mmwA Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium, l-xylarohydroxamate and l- lyxarohydroxamate
65% identity, 99% coverage: 1:381/384 of query aligns to 1:381/381 of 4mmwA
- active site: S136 (= S136), K169 (= K169), H171 (= H171), P181 (= P181), D206 (= D206), F208 (≠ Y208), E232 (= E232), P257 (= P257), E258 (= E258), R280 (= R280), G282 (= G282), H309 (= H309), G310 (= G310), N311 (= N311), E329 (= E329), G331 (= G331), E338 (≠ D338)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: H24 (= H24), C139 (= C139), K169 (= K169), H171 (= H171), D206 (= D206), H209 (= H209), E258 (= E258), H309 (= H309), E329 (= E329)
- binding magnesium ion: D206 (= D206), E232 (= E232), S247 (≠ A247), L250 (= L250), E258 (= E258)
- binding xylarohydroxamate: H24 (= H24), C139 (= C139), K169 (= K169), H171 (= H171), D206 (= D206), H209 (= H209), E258 (= E258), H309 (= H309), E329 (= E329)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
28% identity, 90% coverage: 34:377/384 of query aligns to 20:346/351 of 5olcC
- active site: K148 (= K169), K150 (≠ H171), D178 (= D206), N180 (≠ Y208), E204 (= E232), G229 (≠ P257), E230 (= E258), D253 (≠ G282), H280 (= H309), E304 (≠ Y345), E309 (≠ V350)
- binding magnesium ion: D178 (= D206), E204 (= E232), E230 (= E258)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
31% identity, 88% coverage: 37:372/384 of query aligns to 33:366/378 of 4hpnA
- active site: G50 (≠ P54), R53 (≠ V57), T134 (≠ S136), K164 (= K169), K166 (≠ H171), D194 (= D206), N196 (≠ Y208), E220 (= E232), G245 (≠ P257), E246 (= E258), T247 (≠ S259), Q267 (≠ R280), D269 (≠ G282), H296 (= H309), V297 (vs. gap), W298 (vs. gap), R320 (≠ E329), E329 (≠ D338), F330 (≠ Y339), H334 (≠ A343)
- binding calcium ion: D194 (= D206), D209 (≠ K221), E220 (= E232), G237 (≠ N249), E246 (= E258)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
29% identity, 80% coverage: 66:372/384 of query aligns to 67:363/373 of 3sjnA
- active site: T139 (≠ S136), K165 (= K169), G167 (≠ H171), M171 (≠ F179), D198 (= D206), A200 (≠ G207), E225 (= E232), I247 (= I254), G250 (≠ P257), E251 (= E258), S252 (= S259), Q272 (≠ R280), D274 (≠ G282), H301 (= H309), G302 (= G310), F303 (≠ N311), M325 (≠ H334), E326 (≠ P335), Q329 (≠ D338), S331 (≠ D340)
- binding magnesium ion: D198 (= D206), E225 (= E232), E251 (= E258)
Sites not aligning to the query:
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
28% identity, 82% coverage: 70:384/384 of query aligns to 74:366/369 of 2p8cA
- active site: V136 (≠ S136), F160 (≠ I168), K161 (= K169), M162 (≠ L170), K163 (≠ H171), D191 (= D206), N193 (≠ G207), E218 (= E232), D243 (≠ P257), E244 (= E258), G245 (≠ S259), N265 (≠ R280), K267 (≠ G282), G294 (≠ H309), S295 (≠ G310), M296 (≠ N311), V319 (≠ L337), E320 (≠ D338), L321 (≠ Y339)
- binding magnesium ion: D191 (= D206), E218 (= E232), D243 (≠ P257)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: K163 (≠ H171), D191 (= D206), D243 (≠ P257), K267 (≠ G282), S295 (≠ G310), M296 (≠ N311), E320 (≠ D338), L321 (≠ Y339), T322 (≠ D340)
Sites not aligning to the query:
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
28% identity, 82% coverage: 70:384/384 of query aligns to 74:366/369 of 2p8bA
- active site: V136 (≠ S136), F160 (≠ I168), K161 (= K169), M162 (≠ L170), K163 (≠ H171), D191 (= D206), N193 (≠ G207), E218 (= E232), D243 (≠ P257), E244 (= E258), G245 (≠ S259), N265 (≠ R280), K267 (≠ G282), G294 (≠ H309), S295 (≠ G310), M296 (≠ N311), V319 (≠ L337), E320 (≠ D338), L321 (≠ Y339)
- binding magnesium ion: D191 (= D206), E218 (= E232), D243 (≠ P257)
- binding n-succinyl lysine: V136 (≠ S136), K161 (= K169), K163 (≠ H171), D243 (≠ P257), K267 (≠ G282), S295 (≠ G310), M296 (≠ N311), E320 (≠ D338), L321 (≠ Y339), T322 (≠ D340)
Sites not aligning to the query:
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
28% identity, 82% coverage: 70:384/384 of query aligns to 74:366/369 of 2p88A
- active site: V136 (≠ S136), F160 (≠ I168), K161 (= K169), M162 (≠ L170), K163 (≠ H171), D191 (= D206), N193 (≠ G207), E218 (= E232), D243 (≠ P257), E244 (= E258), G245 (≠ S259), N265 (≠ R280), K267 (≠ G282), G294 (≠ H309), S295 (≠ G310), M296 (≠ N311), V319 (≠ L337), E320 (≠ D338), L321 (≠ Y339)
- binding magnesium ion: D191 (= D206), E218 (= E232), D243 (≠ P257)
Sites not aligning to the query:
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
28% identity, 82% coverage: 70:384/384 of query aligns to 74:366/369 of Q81IL5
- D191 (= D206) binding
- E218 (= E232) binding
- D243 (≠ P257) binding
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
27% identity, 88% coverage: 1:338/384 of query aligns to 1:333/376 of 3bjsB
- active site: V18 (= V18), P49 (vs. gap), S52 (≠ P53), L93 (= L96), G136 (≠ S136), K164 (= K169), R166 (≠ H171), D194 (= D206), N196 (≠ Y208), E220 (= E232), G246 (= G261), E247 (≠ G262), N248 (≠ K263), Q268 (≠ R280), D270 (≠ G282), H297 (= H309), S298 (≠ G310), S299 (vs. gap), E322 (= E329), C324 (≠ G331), K327 (vs. gap)
- binding magnesium ion: D194 (= D206), E220 (= E232), E247 (≠ G262)
3stpA Crystal structure of a putative galactonate dehydratase
30% identity, 86% coverage: 40:368/384 of query aligns to 52:375/390 of 3stpA
- active site: L66 (vs. gap), S69 (≠ E55), S151 (= S136), K177 (= K169), R179 (≠ H171), P189 (= P181), E214 (≠ D206), Y216 (= Y208), E240 (= E232), G265 (= G262), E266 (≠ K263), H267 (= H264), Q287 (≠ R280), D289 (≠ G282), I311 (≠ M304), H316 (= H309), E336 (= E329), F341 (≠ L337)
- binding magnesium ion: E214 (≠ D206), E240 (= E232), E266 (≠ K263)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
28% identity, 87% coverage: 40:374/384 of query aligns to 48:377/386 of 3sqsA
- active site: L62 (vs. gap), N65 (≠ E55), S147 (= S136), K173 (= K169), R175 (≠ H171), G177 (≠ W173), G179 (≠ P175), K181 (≠ I177), A185 (≠ P181), E210 (≠ D206), Y212 (= Y208), E236 (= E232), G261 (= G262), E262 (≠ K263), H263 (= H264), Q283 (≠ R280), D285 (≠ G282), I307 (≠ M304), H312 (= H309), G314 (≠ N311), E332 (= E329), F337 (≠ L337)
- binding magnesium ion: E210 (≠ D206), E236 (= E232), E262 (≠ K263), Y347 (≠ N347), F350 (≠ V350), D351 (vs. gap)
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
28% identity, 90% coverage: 35:381/384 of query aligns to 32:363/364 of 3ugvF
- active site: P51 (= P54), P54 (vs. gap), A95 (vs. gap), S137 (= S136), K168 (= K169), R170 (≠ H171), D199 (= D206), N201 (≠ Y208), E225 (= E232), G250 (≠ P257), E251 (= E258), N252 (≠ S259), M272 (≠ R280), D274 (≠ G282), A293 (≠ S301), H301 (= H309), L302 (≠ G310), Y303 (≠ N311), E321 (= E329)
- binding magnesium ion: D199 (= D206), E225 (= E232), R240 (≠ A247), L243 (= L250), E251 (= E258)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
29% identity, 78% coverage: 70:368/384 of query aligns to 65:342/363 of 2og9A
- active site: T132 (≠ S136), K160 (= K169), K162 (≠ H171), D191 (= D206), N193 (≠ Y208), E217 (= E232), G242 (≠ P257), E243 (= E258), M264 (≠ R280), D266 (≠ G282), H293 (= H309), F294 (≠ G310), A295 (≠ N311), E313 (= E329)
- binding calcium ion: A232 (= A247), F235 (≠ L250)
Sites not aligning to the query:
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
27% identity, 87% coverage: 3:336/384 of query aligns to 5:323/367 of 5xd8B
- active site: S22 (≠ D20), T53 (≠ P54), G140 (= G140), K167 (= K169), K169 (≠ H171), D198 (= D206), N200 (≠ Y208), E224 (= E232), G249 (≠ P257), E250 (= E258), Q271 (≠ R280), D273 (≠ G282), H300 (= H309), G301 (= G310), M302 (≠ N311), W317 (= W327), E319 (= E329)
- binding magnesium ion: D198 (= D206), E224 (= E232), E250 (= E258)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 80% coverage: 2:309/384 of query aligns to 27:328/398 of Q8ZL58
- DAK 46:48 (≠ DS- 20:21) binding
- KR 82:83 (≠ EV 55:56) binding
- K195 (= K169) binding
- K197 (≠ H171) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D206) binding
- N228 (≠ Y208) binding
- E252 (= E232) binding
- E278 (= E258) binding
- H328 (= H309) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
Sites not aligning to the query:
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
30% identity, 63% coverage: 70:309/384 of query aligns to 97:325/395 of 2pp1A
- active site: K192 (= K169), K194 (≠ H171), D223 (= D206), N225 (≠ Y208), E249 (= E232), G274 (≠ P257), E275 (= E258), D298 (≠ G282), H325 (= H309)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: F168 (≠ G146), K194 (≠ H171), E275 (= E258), H325 (= H309)
- binding magnesium ion: D223 (= D206), E249 (= E232), E275 (= E258)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
29% identity, 78% coverage: 70:368/384 of query aligns to 76:353/373 of 3cb3A
- active site: T143 (≠ S136), K171 (= K169), K173 (≠ H171), D202 (= D206), N204 (≠ Y208), E228 (= E232), G253 (≠ P257), E254 (= E258), M275 (≠ R280), D277 (≠ G282), H304 (= H309), F305 (≠ G310), A306 (≠ N311), E324 (= E329)
- binding l-glucaric acid: K171 (= K169), K173 (≠ H171), D202 (= D206), E254 (= E258), H304 (= H309)
- binding magnesium ion: D202 (= D206), E228 (= E232), A243 (= A247), F246 (≠ L250), E254 (= E258)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
30% identity, 63% coverage: 70:309/384 of query aligns to 97:325/395 of 2pp3A
- active site: K192 (= K169), A194 (≠ H171), D223 (= D206), N225 (≠ Y208), E249 (= E232), G274 (≠ P257), E275 (= E258), D298 (≠ G282), H325 (= H309)
- binding l-glucaric acid: K192 (= K169), D223 (= D206), N225 (≠ Y208), E275 (= E258), H325 (= H309)
- binding magnesium ion: D223 (= D206), E249 (= E232), E275 (= E258)
Sites not aligning to the query:
Query Sequence
>BWI76_RS19325 FitnessBrowser__Koxy:BWI76_RS19325
MKIESVNVTVFQYPTRRVSDSAGHSHPGAESMAKMAMLTITADDGTRGFSFAPPEVVRPF
VVNTFFRKVMVGQDPFNRERIWQDLNHWQRGSAHQLTERALSFVEQALWDLIGRKLNMPV
YKLLGGYRDTVPAYGSTMCGDDLPGGLSTPEEYAAFAEKLVARGYKAIKLHTWMPPIAFA
PNPKMDIKACAAVREAVGPDIDLMIDGYHWYSRAEALWIGKELEKLNFAWFEEPMEEDSM
SSYAWLAENLSIPIVGPESFGGKHHMRAEWVKAGACDILRAGANGVGGITPTMKVAALAE
SFGMDCEVHGNGAASLAVVGAIRNCRWYERGLLHPFLDYDEPAAYLNSIVDPMDDQGFVH
LSQRPGLGEDINFAWIEANTVSHD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory