Comparing BWI76_RS19340 FitnessBrowser__Koxy:BWI76_RS19340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
53% identity, 98% coverage: 1:478/487 of query aligns to 1:476/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
52% identity, 98% coverage: 1:478/487 of query aligns to 1:468/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 3:477/487 of query aligns to 5:482/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 3:477/487 of query aligns to 6:484/492 of 3ll3A
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
30% identity, 90% coverage: 1:437/487 of query aligns to 5:469/506 of 3i8bA
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
29% identity, 85% coverage: 5:420/487 of query aligns to 9:431/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 94% coverage: 3:458/487 of query aligns to 2:452/485 of 6k76A
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
27% identity, 90% coverage: 3:441/487 of query aligns to 6:452/497 of O86033
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
25% identity, 90% coverage: 3:441/487 of query aligns to 6:451/496 of P18157
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
25% identity, 91% coverage: 1:441/487 of query aligns to 4:448/495 of 6udeB
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 96% coverage: 3:470/487 of query aligns to 8:499/501 of O34154
Sites not aligning to the query:
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
27% identity, 95% coverage: 3:465/487 of query aligns to 6:470/478 of 5ya2A
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 6:466/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 6:466/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 6:466/494 of 1bwfO
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
27% identity, 95% coverage: 3:465/487 of query aligns to 6:470/478 of 5ya1A
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 4:461/489 of 1gldG
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 4:461/489 of 1glcG
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
24% identity, 94% coverage: 3:458/487 of query aligns to 4:461/489 of 1glbG
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
24% identity, 90% coverage: 3:441/487 of query aligns to 6:451/498 of Q5HGD2
>BWI76_RS19340 FitnessBrowser__Koxy:BWI76_RS19340
MYLGIDLGTSEVKALVIDENNEVIASHSAPLSIQRPHPHWSEQSPQSWWEATEYLMATLR
EKCAQHWPAIKAIGLSGQMHGAVLLDAEGEVIRPAILWNDTRCAAECAELEEMAPELHQV
AGNLAMPGFTAPKLLWVRRHEPQYFQRTATVLLPKDYLRYRMTGKKVSDMSDAAGTLWLD
VAKRDWSDSLLDKCGLSRSQMPTLVEGCEVSATLDPQVAERWGLNASVAVAGGGGDNAVS
AIGVGAVSPGDAFISLGTSGVLFVVTDAYRPAPQSAVHAFCHVLPNLWHQMSVMLSAASC
LQWFCRLTGTTEVALLEEIAQLSEEEKAHAPFFLPYLSGERTPHNDPDARGMFWGMTHSS
LRAQLGYAVLEGVSFGINDGLRVLKESGTRIEQCSLVGGGARSPFWAQLLADILDMPVVT
HKGGETGGALGAARLACLAAGKPLAAVCEKPEVWQTWRADPVRHQTLMRRYAQFNALYLN
DLNYRQH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory