Comparing BWI76_RS19345 FitnessBrowser__Koxy:BWI76_RS19345 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
35% identity, 81% coverage: 9:375/455 of query aligns to 31:401/492 of 1m2wA
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
35% identity, 81% coverage: 9:375/455 of query aligns to 31:401/492 of 1lj8A
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
32% identity, 95% coverage: 8:440/455 of query aligns to 37:475/501 of 7rk5B
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
33% identity, 77% coverage: 8:357/455 of query aligns to 22:372/483 of 4im7A
Sites not aligning to the query:
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
26% identity, 48% coverage: 147:364/455 of query aligns to 104:312/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
23% identity, 48% coverage: 137:356/455 of query aligns to 98:302/388 of Q4X1A4
>BWI76_RS19345 FitnessBrowser__Koxy:BWI76_RS19345
MNNQFTWLHIGLGSFHRAHQAWYLHRLIASGDKRWHIAAGNIRNDAEQVVQALAAQGGRY
VLETVSPEGEREYEEITSIQKLLPWQAGLQPLINEGANPQTKVIAFTVTEGGYYLNTRHQ
LETSNPDLQADLAGECKTIYGTLARILEKRMADNAGPLTLLNCDNVRHNGERFHDGMVEF
LQLTGKQAVIDWMAVNTTCPNTMVDRITPRPAADLPARIKAQTGIDDKAPVMGETFIQWV
VENNFRDERPKLEAVGVEMVASVIPYEEAKIRILNASHSCIAWAGTLIGQQYIHESTLTD
FIYAIADRYVTEDVIPCLGDNGIDLPTYRDVVLKRFTNPYIQDTNQRVAADGFSKIPAMI
APTLQECYQRGVRPEATAMLPALFFVFMEQWHKGTLPYQYQDGILDAQAVHEMFEAQDPV
ALYARNTALFGTLADNADFLALMREKIAAVYTLIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory