SitesBLAST
Comparing BWI76_RS19550 FitnessBrowser__Koxy:BWI76_RS19550 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ipnE The complex structure of 6-phospho-beta-glucosidase bgla-2 with thiocellobiose-6p from streptococcus pneumoniae (see paper)
57% identity, 99% coverage: 4:462/464 of query aligns to 3:462/463 of 4ipnE
4ipnB The complex structure of 6-phospho-beta-glucosidase bgla-2 with thiocellobiose-6p from streptococcus pneumoniae (see paper)
57% identity, 99% coverage: 4:462/464 of query aligns to 3:456/457 of 4ipnB
- active site: R79 (= R81), H124 (= H126), E170 (= E172), S173 (≠ M175), S300 (= S298), Y302 (= Y300), E351 (= E361)
- binding 6-O-phosphono-alpha-L-idopyranose: Q17 (= Q18), H124 (= H126), N169 (= N171), E351 (= E361), W402 (= W408), S409 (= S415), M410 (≠ A416), S411 (= S417)
- binding 4-thio-beta-D-glucopyranose: Y125 (= Y127), E170 (= E172), S173 (≠ M175)
4f66A The crystal structure of 6-phospho-beta-glucosidase from streptococcus mutans ua159 in complex with beta-d-glucose-6-phosphate. (see paper)
52% identity, 100% coverage: 1:462/464 of query aligns to 2:478/478 of 4f66A
- active site: R86 (= R81), H131 (= H126), E177 (= E172), N180 (≠ M175), S312 (= S298), Y314 (= Y300), E376 (= E361)
- binding 6-O-phosphono-beta-D-glucopyranose: Q19 (= Q18), H131 (= H126), F132 (≠ Y127), E177 (= E172), Y314 (= Y300), W350 (= W335), E376 (= E361), W424 (= W408), S431 (= S415), A432 (= A416), G433 (≠ S417), K439 (= K423), Y441 (= Y425)
4f79A The crystal structure of 6-phospho-beta-glucosidase mutant (e375q) in complex with salicin 6-phosphate (see paper)
52% identity, 100% coverage: 1:462/464 of query aligns to 2:478/478 of 4f79A
- active site: R86 (= R81), H131 (= H126), E177 (= E172), N180 (≠ M175), S312 (= S298), Y314 (= Y300), Q376 (≠ E361)
- binding 2-(hydroxymethyl)phenyl 6-O-phosphono-beta-D-glucopyranoside: Q19 (= Q18), H131 (= H126), F132 (≠ Y127), E177 (= E172), Y314 (= Y300), W350 (= W335), Q376 (≠ E361), W424 (= W408), S431 (= S415), A432 (= A416), G433 (≠ S417), K439 (= K423), Y441 (= Y425)
3qomA Crystal structure of 6-phospho-beta-glucosidase from lactobacillus plantarum (see paper)
52% identity, 100% coverage: 2:463/464 of query aligns to 7:479/479 of 3qomA
- active site: R90 (= R81), H135 (= H126), E181 (= E172), N184 (≠ M175), S316 (= S298), Y318 (= Y300), E376 (= E361)
- binding beta-D-glucopyranose: E181 (= E172), N184 (≠ M175), A244 (≠ L227), R268 (≠ W251), W350 (= W335)
- binding phosphate ion: Y28 (= Y23), H65 (≠ D56), H202 (vs. gap), P204 (= P187), G205 (≠ A188), W350 (= W335), A431 (≠ S415), A432 (= A416), S433 (= S417), K439 (= K423), Y441 (= Y425)
4gpnB The crystal structure of 6-p-beta-d-glucosidase (e375q mutant) from streptococcus mutans ua150 in complex with gentiobiose 6-phosphate. (see paper)
52% identity, 99% coverage: 4:462/464 of query aligns to 3:476/476 of 4gpnB
- active site: R84 (= R81), H129 (= H126), E175 (= E172), N178 (≠ M175), S310 (= S298), Y312 (= Y300), Q374 (≠ E361)
- binding 6-O-phosphono-beta-D-glucopyranose: Q17 (= Q18), H129 (= H126), F130 (≠ Y127), E175 (= E172), Y312 (= Y300), W348 (= W335), Q374 (≠ E361), W422 (= W408), S429 (= S415), A430 (= A416), G431 (≠ S417), K437 (= K423), Y439 (= Y425)
- binding beta-D-glucopyranose: E175 (= E172), W348 (= W335)
8b80A The structure of gan1d w433a in complex with galactose-6p
40% identity, 100% coverage: 1:462/464 of query aligns to 2:474/474 of 8b80A
4zfmC Structure of gan1d-e170q in complex with cellobiose-6-phosphate
41% identity, 100% coverage: 1:462/464 of query aligns to 2:461/461 of 4zfmC
- active site: R76 (= R81), H120 (= H126), Q166 (≠ E172), I169 (≠ M175), N295 (≠ S298), Y297 (= Y300), E361 (= E361)
- binding 1,5-anhydro-6-O-phosphono-D-glucitol: Q19 (= Q18), H120 (= H126), Q166 (≠ E172), E361 (= E361), W408 (= W408), S415 (= S415), W416 (≠ A416), Y424 (= Y425)
- binding beta-D-glucopyranose: Q166 (≠ E172), Y297 (= Y300)
5okbB High resolution structure of native gan1d, a putative 6-phospho-beta- galactosidase from geobacillus stearothermophilus (see paper)
40% identity, 100% coverage: 1:462/464 of query aligns to 2:474/474 of 5okbB
4zepA Structure of gan1d, a 6-phospho-beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-glucose
40% identity, 100% coverage: 1:462/464 of query aligns to 2:474/474 of 4zepA
- active site: R76 (= R81), H120 (= H126), E166 (= E172), I169 (≠ M175), N295 (≠ S298), Y297 (= Y300), E374 (= E361)
- binding 6-O-phosphono-beta-D-glucopyranose: Q19 (= Q18), E166 (= E172), Y297 (= Y300), W348 (= W335), E374 (= E361), W421 (= W408), S428 (= S415), K435 (= K423), Y437 (= Y425)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
39% identity, 98% coverage: 4:459/464 of query aligns to 3:422/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (≠ I173), N165 (= N174), L194 (≠ Q202), L195 (= L203), L218 (= L226), L220 (≠ G228), N244 (≠ R249), F247 (= F254), K253 (≠ R260), Y256 (= Y263), L288 (≠ V292), R318 (≠ V348), Y323 (= Y353)
- binding magnesium ion: H346 (≠ N377), K409 (= K446)
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
35% identity, 98% coverage: 4:458/464 of query aligns to 6:442/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H126), E166 (= E172), L173 (≠ H178), E352 (= E361), W398 (= W408), E405 (≠ S415), W406 (≠ A416)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
35% identity, 98% coverage: 4:458/464 of query aligns to 6:442/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q18), H121 (= H126), W122 (≠ Y127), E166 (= E172), L173 (≠ H178), W326 (= W335), E352 (= E361), W398 (= W408), E405 (≠ S415), W406 (≠ A416)
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
35% identity, 98% coverage: 4:458/464 of query aligns to 5:441/447 of 1e4iA
- active site: R76 (= R81), H120 (= H126), E165 (= E172), C168 (≠ N174), N293 (≠ S298), Y295 (= Y300), E351 (= E361)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q18), H120 (= H126), N164 (= N171), E165 (= E172), Y295 (= Y300), E351 (= E361), W397 (= W408), E404 (≠ S415), W405 (≠ A416)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R143), Q140 (≠ G147), V143 (≠ E150), L202 (= L208)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
35% identity, 98% coverage: 4:458/464 of query aligns to 5:441/447 of 1bggB
- active site: R76 (= R81), H120 (= H126), E165 (= E172), C168 (≠ N174), N293 (≠ S298), Y295 (= Y300), E351 (= E361)
- binding D-gluconic acid: Q19 (= Q18), H120 (= H126), W121 (≠ Y127), N164 (= N171), E165 (= E172), Y295 (= Y300), E351 (= E361), W397 (= W408), E404 (≠ S415), W405 (≠ A416)
5yifA Pyruvylated beta-d-galactosidase from bacillus sp. Hma207, e163a mutant pyruvylated beta-d-galactose complex (see paper)
36% identity, 99% coverage: 4:462/464 of query aligns to 3:459/459 of 5yifA
- binding (2R,4aR,6R,7R,8R,8aR)-2-methyl-6,7,8-tris(oxidanyl)-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxine-2-carboxylic acid: Q17 (= Q18), H118 (= H126), N162 (= N171), N295 (≠ S298), Y297 (= Y300), W337 (= W335), E364 (= E361), W410 (= W408), S417 (= S415), W418 (≠ A416), K424 (= K423)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
35% identity, 99% coverage: 1:459/464 of query aligns to 1:440/443 of 2j78A
- active site: R75 (= R81), H119 (= H126), E164 (= E172), V167 (≠ N174), N291 (≠ S298), Y293 (= Y300), E348 (= E361)
- binding calcium ion: E64 (≠ S70), E67 (≠ A73), D276 (= D282), S279 (≠ A286)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q18), H119 (= H126), N163 (= N171), E164 (= E172), Y293 (= Y300), E348 (= E361), W395 (= W408), E402 (≠ S415), W403 (≠ A416), F411 (≠ Y425)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
35% identity, 99% coverage: 1:459/464 of query aligns to 1:441/443 of 5ossB
- active site: R75 (= R81), H119 (= H126), E164 (= E172), V167 (≠ N174), N291 (≠ S298), Y293 (= Y300), E349 (= E361)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q18), H119 (= H126), E164 (= E172), Y293 (= Y300), E349 (= E361), W396 (= W408), E403 (≠ S415), W404 (≠ A416), F412 (≠ Y425)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
35% identity, 99% coverage: 1:459/464 of query aligns to 1:441/443 of 5n6tA
- active site: R75 (= R81), H119 (= H126), E164 (= E172), V167 (≠ N174), N291 (≠ S298), Y293 (= Y300), E349 (= E361)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q18), H119 (= H126), N163 (= N171), E164 (= E172), Y293 (= Y300), E349 (= E361), W396 (= W408), E403 (≠ S415), W404 (≠ A416), F412 (≠ Y425)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
35% identity, 99% coverage: 1:459/464 of query aligns to 1:441/443 of 5n6sA
- active site: R75 (= R81), H119 (= H126), E164 (= E172), V167 (≠ N174), N291 (≠ S298), Y293 (= Y300), E349 (= E361)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q18), H119 (= H126), W120 (≠ Y127), N163 (= N171), E164 (= E172), W166 (vs. gap), V167 (≠ N174), E349 (= E361), W396 (= W408), E403 (≠ S415), W404 (≠ A416), F412 (≠ Y425)
Query Sequence
>BWI76_RS19550 FitnessBrowser__Koxy:BWI76_RS19550
MKTFPQAFLWGGATAANQVEGAYLEDGKGLTTSDVQPRGVFGDVVERVPGDSGIKDIAID
FYHRYPEDISLFAEMGFNCLRVSIAWARIFPHGDEAQPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGNRKVIGFFERYARTVFERYQAKVKLWLTFNEINMSLHAP
MTGVGLPADSSKAEVYQAIHHQLVASALAAKACHDIVPEGKIGNMLLGGLMYPLSCKPDD
IFETLQQNRSWQFFGDVQCRGAYPGYMLRYFRDNGINLDITDADRAALKETVDFISFSYY
MTGCVTADEELNKKARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQVREAIEDGVELMGYTSWGPIDLVSASKAE
MSKRYGFIYVDRDDDGNGTLARSRKKSFWWYKEVIATNGGSLKE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory