Comparing BWI76_RS19575 FitnessBrowser__Koxy:BWI76_RS19575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
45% identity, 98% coverage: 1:210/214 of query aligns to 3:212/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
45% identity, 99% coverage: 1:211/214 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
45% identity, 99% coverage: 1:211/214 of query aligns to 1:211/212 of O86043
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
44% identity, 97% coverage: 3:210/214 of query aligns to 8:209/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
44% identity, 97% coverage: 3:210/214 of query aligns to 4:205/208 of 1fw1A
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
43% identity, 97% coverage: 3:210/214 of query aligns to 5:206/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
43% identity, 97% coverage: 3:210/214 of query aligns to 8:209/216 of Q9WVL0
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
38% identity, 100% coverage: 1:213/214 of query aligns to 8:214/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
38% identity, 100% coverage: 1:213/214 of query aligns to 10:216/222 of 4kdyA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
37% identity, 98% coverage: 1:210/214 of query aligns to 6:224/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
37% identity, 98% coverage: 1:210/214 of query aligns to 4:222/228 of 3n5oA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
34% identity, 97% coverage: 1:208/214 of query aligns to 3:211/216 of 4pxoA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
27% identity, 93% coverage: 1:200/214 of query aligns to 2:195/206 of 4hz2B
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
26% identity, 92% coverage: 9:205/214 of query aligns to 11:203/219 of 3qawA
4mk3A Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
27% identity, 78% coverage: 1:167/214 of query aligns to 1:160/203 of 4mk3A
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
26% identity, 88% coverage: 2:189/214 of query aligns to 4:185/201 of 3m3mA
3vlnA Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid (see paper)
23% identity, 94% coverage: 1:202/214 of query aligns to 22:212/239 of 3vlnA
3ublA Crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound
28% identity, 78% coverage: 1:166/214 of query aligns to 3:154/212 of 3ublA
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
28% identity, 95% coverage: 1:203/214 of query aligns to 2:196/203 of 3uarA
4ivfF Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
25% identity, 93% coverage: 1:199/214 of query aligns to 4:209/227 of 4ivfF
>BWI76_RS19575 FitnessBrowser__Koxy:BWI76_RS19575
MKLYSFFNSSASYRVRIALALKGIDYQSVGVNIRIGQQNALEYRRLNPVGLVPTLITDKG
ESLGQSLAIADWLDRHYPQPLLLPQADSARMRVLEIVYAIACDIHPINNMRVLRYLGDEL
KVSEEEKKRWYAHWIQQGFSAVEQLLRHAKSGDFCVGDAPTLADCCLVPQWANALRMGCD
LSHYPRCQAVYDACTRLPAFIAAAPENQQDKIPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory