Comparing BWI76_RS19645 FitnessBrowser__Koxy:BWI76_RS19645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
94% identity, 100% coverage: 1:332/332 of query aligns to 1:332/332 of P23905
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
95% identity, 99% coverage: 1:329/332 of query aligns to 1:329/332 of P0AEE5
1gcaA The 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium (see paper)
94% identity, 93% coverage: 24:332/332 of query aligns to 1:309/309 of 1gcaA
3ga5A X-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside (see paper)
95% identity, 92% coverage: 26:329/332 of query aligns to 1:304/305 of 3ga5A
2gbpA Sugar and signal-transducer binding sites of the escherichia coli galactose chemoreceptor protein (see paper)
94% identity, 93% coverage: 24:332/332 of query aligns to 1:309/309 of 2gbpA
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
94% identity, 92% coverage: 25:329/332 of query aligns to 1:305/305 of 2qw1A
8fxtA Escherichia coli periplasmic glucose-binding protein glucose complex: acrylodan conjugate attached at w183c (see paper)
94% identity, 92% coverage: 26:329/332 of query aligns to 2:305/305 of 8fxtA
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
89% identity, 92% coverage: 24:329/332 of query aligns to 1:306/307 of 5kwsA
4z0nA Crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi- 511281) with bound d-galactose
62% identity, 91% coverage: 28:329/332 of query aligns to 4:305/307 of 4z0nA
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
50% identity, 91% coverage: 28:328/332 of query aligns to 6:308/310 of 8fxuA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 92% coverage: 28:332/332 of query aligns to 9:286/287 of 4yo7A
6bgcA The crystal structure of the w145a variant of tpmglb-2 (tp0684) with bound glucose (see paper)
33% identity, 58% coverage: 105:298/332 of query aligns to 1:225/364 of 6bgcA
Sites not aligning to the query:
6bgdA The crystal structure of the w145a variant of tpmglb-2 (tp0684) with bound ligand (see paper)
33% identity, 59% coverage: 104:298/332 of query aligns to 4:229/373 of 6bgdA
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 85% coverage: 20:301/332 of query aligns to 29:295/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
30% identity, 83% coverage: 26:301/332 of query aligns to 3:263/315 of 4rsmA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 85% coverage: 20:300/332 of query aligns to 29:290/349 of A0QYB3
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
29% identity, 83% coverage: 27:300/332 of query aligns to 3:257/314 of 5hkoA
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
29% identity, 83% coverage: 27:300/332 of query aligns to 3:257/315 of 4rs3A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
29% identity, 75% coverage: 28:277/332 of query aligns to 3:233/274 of 2ioyA
Sites not aligning to the query:
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
28% identity, 80% coverage: 66:330/332 of query aligns to 42:317/329 of 3uugA
Sites not aligning to the query:
>BWI76_RS19645 FitnessBrowser__Koxy:BWI76_RS19645
MNKKVLTLSAVMASMLFGAAAHAADTRIGVTIYKYDDNFMSVVRKAIEKDGKSAPDVQLL
MNDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAGTVIDKARGQNVPVVFFNKEPSRK
ALDSYDKAYYVGTDSKESGVIQGDLIAKHWKANPNWDLNKDGQIQFVLLKGEPGHPDAEA
RTTYVIKELNDKGFKTQQLALDTAMWDTAQAKDKMDAWLSGPNANKIEVVIANNDAMAMG
AVEALKAHNKSSIPVFGVDALPEALALVKSGAMAGTVLNDANNQAKATFDLAKNLADGKE
PAAGTNWKIENKIVRVPYVGVDKDNLSEFIGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory