Comparing BWI76_RS19735 BWI76_RS19735 bifunctional PTS fructose transporter subunit IIA/HPr protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
46% identity, 38% coverage: 1:143/376 of query aligns to 493:637/637 of P00550
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
45% identity, 38% coverage: 1:141/376 of query aligns to 1:143/144 of 1j6tA
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
40% identity, 36% coverage: 4:139/376 of query aligns to 4:139/143 of C0H3V2
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
45% identity, 23% coverage: 290:374/376 of query aligns to 5:87/87 of Q9F166
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
45% identity, 22% coverage: 287:368/376 of query aligns to 3:81/87 of P24366
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
43% identity, 23% coverage: 287:374/376 of query aligns to 3:88/88 of Q9CJ83
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
40% identity, 23% coverage: 290:374/376 of query aligns to 6:88/88 of O69250
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
38% identity, 23% coverage: 290:374/376 of query aligns to 6:88/88 of P08877
Sites not aligning to the query:
Q9WXK8 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus equinus (Streptococcus bovis) (see paper)
46% identity, 18% coverage: 287:354/376 of query aligns to 3:67/87 of Q9WXK8
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
36% identity, 23% coverage: 285:369/376 of query aligns to 1:82/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
36% identity, 23% coverage: 285:369/376 of query aligns to 1:82/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
36% identity, 23% coverage: 285:369/376 of query aligns to 1:82/85 of P0AA04
O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
36% identity, 20% coverage: 292:365/376 of query aligns to 8:78/85 of O06976
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
34% identity, 25% coverage: 280:374/376 of query aligns to 150:241/472 of P37349
Sites not aligning to the query:
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
35% identity, 27% coverage: 38:139/376 of query aligns to 542:646/650 of O31645
Sites not aligning to the query:
O50515 Phosphocarrier protein HPr; Histidine-containing protein from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
33% identity, 21% coverage: 296:374/376 of query aligns to 12:88/93 of O50515
Sites not aligning to the query:
Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
33% identity, 20% coverage: 289:364/376 of query aligns to 5:77/88 of Q84F84
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
24% identity, 31% coverage: 13:130/376 of query aligns to 521:637/648 of O31644
Sites not aligning to the query:
P75061 Phosphocarrier protein HPr; Histidine-containing protein from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
29% identity, 20% coverage: 289:364/376 of query aligns to 5:78/88 of P75061
>BWI76_RS19735 BWI76_RS19735 bifunctional PTS fructose transporter subunit IIA/HPr protein
MFQLSVQDIHPGQQAGNKEEAIRQVASALVSAGNVADGYVNGMLAREQQTSTFLGNGIAI
PHGTTDTRDQVLKTGVQVYQFPQGVTWGEGQTAYVAIGIAASSDEHLGLLRQLTHVLSDD
SVAEQLKSATTAEELRALLMGEKQSEALKLDNETLTLDVAASDLLTLQALNAARLKEAGA
VDASFVSRTINDKPLNLGQGIWLNDSTEGNLRSAVAVSRAANAFTSDEQPVSLLITVAMA
DDQPTAVLNRLSNLLLDKKADRLLKADGATLLALLTSDDAIAEDVLSAEYVIRNEHGLHA
RPGTMLVNTIKQFSSDITVTNLDGSGKPANGRSLMKVVALGVKKGHRLRFTAQGEDAQQA
LDAIGEAIAAGLGEGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory