Comparing BWI76_RS19875 FitnessBrowser__Koxy:BWI76_RS19875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5da0A Structure of the the slc26 transporter slc26dg in complex with a nanobody (see paper)
49% identity, 90% coverage: 28:401/415 of query aligns to 10:376/467 of 5da0A
Sites not aligning to the query:
Q55415 Bicarbonate transporter BicA from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
26% identity, 80% coverage: 26:355/415 of query aligns to 12:366/564 of Q55415
Sites not aligning to the query:
6ki1B The transmembrane domain of a cyanobacterium bicarbonate transporter bica (see paper)
26% identity, 80% coverage: 26:355/415 of query aligns to 11:365/392 of 6ki1B
7lhvA Structure of arabidopsis thaliana sulfate transporter atsultr4;1 (see paper)
23% identity, 78% coverage: 18:339/415 of query aligns to 18:370/575 of 7lhvA
Sites not aligning to the query:
P58735 Sulfate anion transporter 1; SAT-1; Solute carrier family 26 member 1 from Mus musculus (Mouse) (see paper)
22% identity, 67% coverage: 21:300/415 of query aligns to 64:414/704 of P58735
Sites not aligning to the query:
7v75A Thermostabilized human prestin in complex with salicylate (see paper)
27% identity, 72% coverage: 108:406/415 of query aligns to 118:442/605 of 7v75A
7v74A Thermostabilized human prestin in complex with sulfate (see paper)
27% identity, 72% coverage: 108:406/415 of query aligns to 118:442/597 of 7v74A
Sites not aligning to the query:
Q96RN1 Testis anion transporter 1; Anion exchange transporter; Solute carrier family 26 member 8 from Homo sapiens (Human) (see 4 papers)
22% identity, 75% coverage: 29:339/415 of query aligns to 95:463/970 of Q96RN1
Sites not aligning to the query:
>BWI76_RS19875 FitnessBrowser__Koxy:BWI76_RS19875
MPPVSDSATSGNAGALGQILRSPALLTRETLAGVLTALALIPEVISFSVIAGVDPKVSLI
ASVVLCLAMSLLGGRPAMVTAAAGSVALVIGPMVHQYGVGYILPAVVLAGVIQILFGVCG
MARLMRFIPQAVMTGFVNALGILIFFAQVPHFWSKQPLIIGLFVLTLLIVLWAPRFIKAI
PSPLIAIVLLTLFTVFSGQLLPTVGDEGSMSGGLPGFTSLMVPLDLTTLSIIWPCALSIA
FVGLMESLLTAKLVDDLTHTPSSKARESAGLGIANILAGFYGGIAGCAMIGQTIVNVEMG
KARSRVSTIVAGLVLLLLVTALSEVMAKIPMAVLAGVMVIVAVKTFSWHSVRPAELARNP
WPETLVMLVTVGATVSTSNLAIGVLAGLVSMALIPRRLRNQARATSEKSSPAQEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory