SitesBLAST
Comparing BWI76_RS19960 FitnessBrowser__Koxy:BWI76_RS19960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
32% identity, 98% coverage: 10:447/448 of query aligns to 6:456/463 of P0AGC0
- C108 (≠ V106) mutation to S: No change in activity.
- C143 (≠ P140) mutation to S: 30% of wild-type sugar phosphate transport activity.
- C265 (≠ A259) mutation to S: No change in activity.
- C331 (≠ V326) mutation to S: No change in activity.
- C436 (≠ A427) mutation to S: No change in activity.
- C438 (≠ L429) mutation to S: No change in activity.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 93% coverage: 25:441/448 of query aligns to 12:428/430 of P0AA76
- Y29 (= Y42) binding
- D31 (≠ V44) mutation to N: Loss of galactonate transport activity.
- R32 (= R45) binding
- Y64 (= Y76) binding
- E118 (≠ Q134) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ G369) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 93% coverage: 25:441/448 of query aligns to 1:409/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
21% identity, 93% coverage: 25:441/448 of query aligns to 4:393/393 of 6e9oA
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 51% coverage: 67:295/448 of query aligns to 144:412/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
23% identity, 62% coverage: 15:291/448 of query aligns to 27:327/495 of Q9NRA2
- R39 (= R27) to C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- K136 (≠ R93) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ G142) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ IV 157:158) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ DY 230:231) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ SEKHE 232:236) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 328 G → E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- 334 P → R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
O82811 High-affinity nitrate transporter 2.1; AtNRT2:1; Protein ACH1; Protein LATERAL ROOT INITIATION 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 54% coverage: 31:271/448 of query aligns to 76:289/530 of O82811
- G119 (= G84) mutation to R: In lin1; reduced nitrate uptake and increased lateral root initiation.
Query Sequence
>BWI76_RS19960 FitnessBrowser__Koxy:BWI76_RS19960
MLSIFKPAAHKARLPTAEIDPLYRRLRWQIFIGIFFGYAAYYLVRKNFALAMPYLIEQGF
SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRIFLPAGLILAALVMLVMGFVPWATSSI
MVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGM
AWFNDWHAALYMPAFGAILLAIFAFAMMRDTPQSCGLPPIEEYKNDYPDDYSEKHEEELT
AKQIFMQYILPNKLLWYIAVANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEY
AGIPGTLLCGWMSDKVFKGNRGATGVFFMTLVTIATVVYWLNPPGNPGVDMACMIIIGFL
IYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVM
IGGSVLAVLLLIIVMLGERRHHQQMKQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory