SitesBLAST
Comparing BWI76_RS19965 FitnessBrowser__Koxy:BWI76_RS19965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 72% coverage: 8:394/540 of query aligns to 75:484/629 of Q9SS48
- S86 (≠ A19) mutation to F: In spd6-2; loss of 90% of activity.
Sites not aligning to the query:
- 546 E→G: In spd6-1; loss of 90% of activity.
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 62% coverage: 29:363/540 of query aligns to 41:393/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (= E36), M49 (≠ R37), Q50 (≠ Y38), T56 (≠ A44), S57 (≠ T45), A197 (≠ V172), S232 (≠ A207), G233 (= G208), W235 (= W210), G257 (= G229), G344 (= G311), L345 (≠ V312), Y357 (≠ P322), K382 (= K352), I383 (≠ L353), T384 (≠ M354)
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
27% identity, 62% coverage: 29:363/540 of query aligns to 39:385/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E36), M47 (≠ R37), Q48 (≠ Y38), T54 (≠ A44), S55 (≠ T45), S58 (≠ N48), T59 (≠ H49), A193 (≠ V172), S227 (≠ A207), G228 (= G208), W230 (= W210), L338 (≠ V312), R339 (= R313), Y350 (≠ V327), K374 (= K352), I375 (≠ L353), T376 (≠ M354)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
29% identity, 71% coverage: 5:386/540 of query aligns to 17:354/496 of 3da1A
- binding flavin-adenine dinucleotide: I24 (= I12), G27 (= G15), I28 (≠ A16), T29 (= T17), E48 (= E36), M49 (≠ R37), G55 (= G43), S57 (≠ T45), S60 (≠ N48), T61 (≠ H49), L63 (= L51), H65 (= H53), V151 (= V172), G187 (= G208), W189 (= W210), L193 (≠ I214), G210 (= G229), T250 (= T266), G296 (= G311), R298 (= R313), G319 (= G351), K320 (= K352), L321 (= L353)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
25% identity, 81% coverage: 30:465/540 of query aligns to 27:475/501 of 2qcuB
- binding flavin-adenine dinucleotide: E33 (= E36), A34 (≠ R37), C39 (≠ T42), T41 (≠ A44), S42 (≠ T45), S45 (≠ N48), S46 (≠ H49), L48 (= L51), H50 (= H53), A172 (≠ V172), T206 (≠ A207), W209 (= W210), G231 (≠ D235), R317 (= R313), G353 (= G351), K354 (= K352), L355 (= L353), T356 (≠ M354)
- binding phosphate ion: R54 (= R57), Y55 (= Y58), R317 (= R313), R332 (= R329)
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
25% identity, 81% coverage: 30:465/540 of query aligns to 27:475/495 of 2r46A
- binding flavin-adenine dinucleotide: L32 (≠ V35), E33 (= E36), A34 (≠ R37), T41 (≠ A44), S42 (≠ T45), A44 (≠ R47), S45 (≠ N48), S46 (≠ H49), L48 (= L51), A172 (≠ V172), T206 (≠ A207), G231 (≠ D235), R317 (= R313), G353 (= G351), K354 (= K352), L355 (= L353), T356 (≠ M354)
- binding phosphoenolpyruvate: R54 (= R57), Y55 (= Y58), R254 (vs. gap), T270 (= T266), D272 (≠ S268), R317 (= R313), R332 (= R329)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ L157), V455 (= V446), D456 (≠ E447), H457 (≠ N448), W459 (≠ A450)
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
25% identity, 81% coverage: 30:465/540 of query aligns to 27:475/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R57), Y55 (= Y58), R254 (vs. gap), I255 (vs. gap), T270 (= T266), R317 (= R313), R332 (= R329)
- binding flavin-adenine dinucleotide: E33 (= E36), A34 (≠ R37), C39 (≠ T42), A40 (≠ G43), T41 (≠ A44), S42 (≠ T45), A44 (≠ R47), S45 (≠ N48), S46 (≠ H49), L48 (= L51), A172 (≠ V172), T206 (≠ A207), G207 (= G208), W209 (= W210), G231 (≠ D235), R317 (= R313), G353 (= G351), K354 (= K352), L355 (= L353), T356 (≠ M354)
- binding phosphate ion: Q212 (≠ E216), G277 (≠ Y273), P279 (≠ E275), V310 (≠ L306), Y398 (≠ P390), R401 (≠ T393), R405 (≠ K397), R462 (≠ N453), D464 (≠ L455), W468 (≠ R458)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ L157), V160 (≠ R160), V455 (= V446), D456 (≠ E447), H457 (≠ N448), W459 (≠ A450)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
30% identity, 43% coverage: 6:237/540 of query aligns to 1:230/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I12), G8 (= G13), G10 (= G15), V11 (≠ A16), I12 (≠ T17), V30 (= V35), E31 (= E36), K32 (≠ R37), E38 (≠ G43), A39 (= A44), S40 (≠ T45), A43 (≠ N48), G45 (= G50), L46 (= L51), V171 (= V172), G200 (≠ A207), G201 (= G208), W203 (= W210)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
25% identity, 41% coverage: 22:244/540 of query aligns to 20:238/374 of 1y56B
- active site: F44 (≠ G46), G47 (≠ H53), T48 (≠ S54), H224 (≠ G229)
- binding flavin-adenine dinucleotide: I33 (≠ V35), E34 (= E36), K35 (≠ R37), S42 (≠ A44), T43 (= T45), R45 (= R47), C46 (≠ L52), G47 (≠ H53), G49 (= G55), E170 (= E171), V171 (= V172), T200 (≠ A207), N201 (≠ G208), W203 (= W210)
- binding flavin mononucleotide: F44 (≠ G46), R45 (= R47)
Sites not aligning to the query:
- active site: 239, 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
22% identity, 58% coverage: 8:321/540 of query aligns to 5:328/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G13), G12 (= G15), I14 (≠ T17), E33 (= E36), K34 (≠ R37), E41 (≠ G43), T42 (≠ A44), S43 (≠ T45), A45 (≠ R47), N46 (= N48), S47 (≠ H49), V49 (≠ L51), H51 (= H53), E176 (= E171), V177 (= V172), A209 (= A207), G210 (= G208), Y212 (≠ W210), Y234 (≠ L231), S319 (≠ V312), R320 (= R313)
- binding sn-glycerol-3-phosphate: S47 (≠ H49), H51 (= H53), K258 (≠ D251), G259 (≠ A252), R320 (= R313)
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
22% identity, 58% coverage: 8:321/540 of query aligns to 5:328/384 of P75063
Sites not aligning to the query:
- 346:347 binding
- 352 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
26% identity, 42% coverage: 8:233/540 of query aligns to 7:230/824 of 4pabB
- active site: T53 (vs. gap), E102 (≠ D98), H226 (≠ G229)
- binding flavin-adenine dinucleotide: I11 (= I12), G12 (= G13), G14 (= G15), C15 (≠ A16), V16 (≠ T17), L35 (≠ V35), E36 (= E36), K37 (≠ R37), G43 (= G43), S44 (≠ A44), T45 (= T45), H47 (≠ R47), A48 (≠ N48), A49 (≠ H49), G50 (= G50), L51 (= L51), V175 (= V172), A204 (= A207), G205 (= G208), W207 (= W210), H226 (≠ G229), Y228 (≠ L231)
Sites not aligning to the query:
- active site: 255, 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 42% coverage: 8:233/540 of query aligns to 44:267/857 of Q63342
- CV 52:53 (≠ AT 16:17) binding
- EK 73:74 (≠ ER 36:37) binding
- 80:88 (vs. 43:51, 44% identical) binding
- H84 (≠ R47) modified: Tele-8alpha-FAD histidine
- V212 (= V172) binding
- W244 (= W210) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
26% identity, 42% coverage: 8:233/540 of query aligns to 51:274/866 of Q9UI17
- CV 59:60 (≠ AT 16:17) binding
- EK 80:81 (≠ ER 36:37) binding
- 87:95 (vs. 43:51, 44% identical) binding
- H91 (≠ R47) modified: Tele-8alpha-FAD histidine
- H109 (≠ D62) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V172) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
31% identity, 39% coverage: 6:215/540 of query aligns to 2:211/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I12), G9 (= G13), G11 (= G15), V12 (≠ A16), V13 (≠ T17), E32 (= E36), A33 (≠ R37), T41 (≠ A44), S42 (≠ T45), R44 (= R47), N45 (= N48), S46 (≠ H49), V48 (≠ L51), H50 (= H53), P170 (≠ G174), L171 (= L175), A203 (= A207)
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
26% identity, 40% coverage: 9:226/540 of query aligns to 4:219/827 of 1pj7A
- binding flavin-adenine dinucleotide: G8 (= G13), G10 (= G15), I11 (≠ A16), V12 (≠ T17), D32 (vs. gap), Q33 (vs. gap), G41 (= G43), S42 (≠ A44), T43 (= T45), H45 (≠ R47), P47 (≠ H49), L49 (= L51), T170 (≠ E171), V171 (= V172), A200 (= A207), G201 (= G208), W203 (= W210)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
26% identity, 40% coverage: 9:226/540 of query aligns to 5:220/828 of 1pj6A
- binding flavin-adenine dinucleotide: G9 (= G13), G11 (= G15), I12 (≠ A16), V13 (≠ T17), D33 (vs. gap), Q34 (vs. gap), G42 (= G43), S43 (≠ A44), T44 (= T45), H46 (≠ R47), P48 (≠ H49), L50 (= L51), V172 (= V172), A201 (= A207), G202 (= G208), W204 (= W210)
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
26% identity, 40% coverage: 9:226/540 of query aligns to 7:222/830 of Q9AGP8
- IV 14:15 (≠ AT 16:17) binding
- DQ 35:36 (vs. gap) binding
- STSH 45:48 (≠ ATGR 44:47) binding
- L52 (= L51) binding
- V174 (= V172) binding
Sites not aligning to the query:
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 40% coverage: 9:226/540 of query aligns to 4:219/827 of 3gsiA
- binding flavin-adenine dinucleotide: G10 (= G15), I11 (≠ A16), V12 (≠ T17), D32 (vs. gap), Q33 (vs. gap), G41 (= G43), S42 (≠ A44), T43 (= T45), H45 (≠ R47), P47 (≠ H49), L49 (= L51), T170 (≠ E171), V171 (= V172), A200 (= A207), G201 (= G208), W203 (= W210)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 58% coverage: 4:314/540 of query aligns to 1:308/368 of 4yshB
- active site: A45 (≠ N48), M48 (≠ L51), L49 (= L52), Q52 (≠ G55), I262 (= I264), L283 (= L289), G305 (= G311)
- binding flavin-adenine dinucleotide: V9 (≠ I12), G10 (= G13), G12 (= G15), I14 (≠ T17), F32 (≠ V35), E33 (= E36), K34 (≠ R37), G40 (= G43), A41 (= A44), S42 (≠ T45), A45 (≠ N48), A46 (≠ H49), M48 (≠ L51), V178 (= V172), S206 (≠ A207), W209 (= W210), R307 (= R313)
- binding glycine: G249 (≠ A252), Y251 (≠ I254), Y251 (≠ I254), A264 (≠ T266), R307 (= R313)
Sites not aligning to the query:
Query Sequence
>BWI76_RS19965 FitnessBrowser__Koxy:BWI76_RS19965
MADSREYDVIIIGGGATGAGIARDCALRGLKAALVERYDIATGATGRNHGLLHSGARYAV
TDSESARECISENRILRRIARHCIEPTSGLFITLPEDDPAYQHTFITACQQAGIEAQPLT
PAETLRLEPAVNPALLGAVQVPDGTVDPFRLTAANMLDAREHGATILTGCEVTGLLREGD
RVQGVALYDRQRREPLSLRAQVVVNAAGIWGQRIAEYADLRIAMFPAKGSLLILDHRINR
QVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAGEVDTLLREGEKLAPIM
GRTRILRAYSGVRPLVASDDDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTAPCTTADAPLPGSQEPTETTLRKIIALPASLRGSAIYRHGDRTPAW
LGDSRQHRSLVCECEAVTAGEVQYAVENLAVKNLLDLRRRTRVGMGTCQGELCACRAAGL
LARFNVTTSARSLTQLSEFLNERWKGVQPVAWGDALRESEFTRWVYLGLCGLQKEHQDEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory