SitesBLAST
Comparing BWI76_RS20455 BWI76_RS20455 multifunctional fatty acid oxidation complex subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
80% identity, 99% coverage: 4:707/714 of query aligns to 1:703/707 of 6yswA
- active site: A66 (= A69), I71 (= I74), A84 (= A87), Q88 (= Q91), G112 (= G115), E115 (= E118), P136 (= P139), E137 (= E140), G145 (= G148), D264 (≠ A267), S422 (= S425), H443 (= H446), E455 (= E458), N493 (= N496)
- binding coenzyme a: E23 (= E26), M25 (= M28), A66 (= A69), D67 (= D70), I68 (= I71), P136 (= P139), E137 (= E140), L140 (= L143), T290 (= T293), K293 (= K296)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
41% identity, 96% coverage: 15:700/714 of query aligns to 48:754/763 of P40939
- V282 (≠ L228) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L251) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ I288) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E458) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
35% identity, 98% coverage: 6:707/714 of query aligns to 7:714/715 of 1wdlA
- active site: A69 (= A69), N89 (vs. gap), N93 (≠ Q91), G117 (= G115), E120 (= E118), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S425), H451 (= H446), E463 (= E458), N501 (= N496)
- binding nicotinamide-adenine-dinucleotide: A322 (≠ G316), I324 (≠ L318), M325 (= M319), D344 (= D339), I345 (= I340), A400 (= A395), V401 (= V396), E403 (= E398), N428 (= N423), T429 (= T424), S430 (= S425)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
35% identity, 98% coverage: 6:707/714 of query aligns to 7:714/715 of P28793
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 98% coverage: 9:711/714 of query aligns to 10:718/729 of P21177
- G116 (= G115) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G317) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H446) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
35% identity, 98% coverage: 9:711/714 of query aligns to 10:718/719 of 6tnmA
- active site: A68 (= A69), F73 (≠ I74), G116 (= G115), E119 (= E118), P138 (= P139), E139 (= E140), G147 (= G148), N271 (≠ A267), S429 (= S425), H450 (= H446), E462 (= E458), N500 (= N496)
- binding adenosine-5'-triphosphate: D343 (= D339), I344 (= I340), V400 (= V396), V401 (≠ F397), V406 (≠ L402), K584 (= K578)
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
35% identity, 98% coverage: 6:707/714 of query aligns to 7:706/707 of 1wdmA
- active site: A69 (= A69), N89 (vs. gap), N93 (≠ Q91), G117 (= G115), E120 (= E118), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S425), H451 (= H446), E463 (= E458), N501 (= N496)
- binding acetyl coenzyme *a: K142 (≠ Q142), D297 (≠ S292), M459 (= M454), N501 (= N496), P534 (= P529), Y652 (≠ F652), L658 (≠ P658)
- binding nicotinamide-adenine-dinucleotide: G321 (= G315), A322 (≠ G316), I324 (≠ L318), M325 (= M319), D344 (= D339), V401 (= V396), E403 (= E398), N428 (= N423), S430 (= S425), N454 (≠ S449)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
34% identity, 96% coverage: 14:697/714 of query aligns to 11:710/711 of 7o4uA
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
32% identity, 97% coverage: 14:706/714 of query aligns to 8:690/692 of 6iunB
- active site: A60 (= A69), F65 (≠ I74), E73 (= E82), H77 (≠ Q91), G101 (= G115), E104 (= E118), E124 (= E140), G132 (= G148), K248 (≠ A267), S407 (= S425), H428 (= H446), E440 (= E458), N478 (= N496)
- binding nicotinamide-adenine-dinucleotide: G300 (= G317), T301 (≠ L318), M302 (= M319), E321 (≠ D339), T322 (≠ I340), Y365 (= Y383), A377 (= A395), V378 (= V396), E380 (= E398), V384 (≠ L402), V388 (≠ M406), N405 (= N423), S407 (= S425)
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G68), G77 (≠ A69), T81 (≠ M73), M82 (≠ I74), M82 (≠ I74), A85 (= A75), D89 (≠ S79), T96 (≠ L86), L123 (= L113), G124 (= G114), P149 (= P139), E150 (= E140), S366 (≠ Q341), L367 (≠ P342), E368 (≠ R343), A420 (= A395), V421 (= V396), F422 (= F397)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G68), F169 (≠ I159), N173 (≠ G163), S177 (≠ M167), I193 (≠ A182), F313 (= F290)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L31), N40 (≠ K32), E41 (≠ A33), T81 (≠ M73), D92 (≠ E82), V93 (≠ A83)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L31), G77 (≠ A69), D78 (= D70), M82 (≠ I74), V93 (≠ A83)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ Q142), R184 (≠ Q173), A311 (≠ I288), F312 (= F289), I673 (= I648)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
34% identity, 96% coverage: 14:697/714 of query aligns to 23:729/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L31), N41 (≠ K32), E42 (≠ A33), G77 (= G68), G78 (≠ A69), D79 (= D70), V80 (≠ I71), D90 (≠ S79), V94 (≠ A83), L124 (= L113), G125 (= G114), P150 (= P139), E151 (= E140)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ A33), G76 (= G68), G77 (≠ A69), D78 (= D70), V79 (≠ I71), M82 (≠ I74), D89 (≠ S79), V93 (≠ A83), T96 (≠ L86), T96 (≠ L86), P149 (= P139), E150 (= E140)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L31), M82 (≠ I74), E150 (= E140), Q172 (≠ S162), F175 (≠ L165), V176 (≠ E166), Q181 (vs. gap), T241 (≠ R225), F254 (≠ L231), N257 (≠ K234), Q261 (≠ H238), L262 (≠ K239), P266 (≠ N243), P268 (= P245), Q282 (≠ A259), V283 (≠ Q260), G302 (≠ T279), Q303 (≠ P280), V304 (≠ Q281), S521 (≠ N496), G525 (≠ A500)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/729 of 8opvA
- binding resveratrol: M39 (≠ L31), A75 (= A67), G76 (= G68), M82 (≠ I74), E128 (= E118), P149 (= P139), E150 (= E140), T152 (≠ Q142), L153 (= L143), R184 (≠ Q173), F296 (= F273)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
34% identity, 96% coverage: 14:697/714 of query aligns to 22:728/729 of 8opuA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
34% identity, 96% coverage: 14:697/714 of query aligns to 28:734/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (≠ L31), I50 (≠ A36), G82 (= G68), G83 (≠ A69), D84 (= D70), T87 (≠ M73), T87 (≠ M73), M88 (≠ I74), M88 (≠ I74), A91 (= A75), D95 (≠ S79), D98 (≠ E82), V99 (≠ A83), T102 (≠ L86), T102 (≠ L86), E134 (= E118), E156 (= E140), L159 (= L143), F302 (= F273), F302 (= F273), F319 (= F290), S456 (= S425), T457 (≠ S426), M485 (= M454), P486 (= P455), G523 (= G492), S527 (≠ N496), N535 (= N504), P560 (= P529), M575 (≠ G544), I578 (= I547), I578 (= I547), I682 (≠ V651), M683 (≠ F652), G686 (= G655)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 96% coverage: 14:697/714 of query aligns to 16:722/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
34% identity, 96% coverage: 14:697/714 of query aligns to 16:722/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ E26), S29 (≠ K27), A63 (= A60), K64 (= K61), K64 (= K61), K65 (≠ D63), P143 (= P139), E144 (= E140), L147 (= L143), F307 (= F290), M473 (= M454), P548 (= P529), S599 (≠ K575), L602 (≠ K578), K603 (≠ N579), S661 (= S642), T662 (≠ A643), G674 (= G655), A698 (≠ V675), R705 (≠ Q680)
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 96% coverage: 14:697/714 of query aligns to 21:727/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ T30), N39 (≠ K32), G75 (= G68), D77 (= D70), M81 (≠ I74), V92 (≠ A83), T95 (≠ L86), P148 (= P139), E149 (= E140), L152 (= L143), Q180 (vs. gap), Q260 (≠ H238), K362 (= K338), D363 (= D339), V364 (≠ I340), V430 (≠ M406), D476 (= D452), K477 (= K453), M478 (= M454), P479 (= P455), K506 (= K482)
- binding formamide: V78 (≠ I71), K79 (≠ N72)
Query Sequence
>BWI76_RS20455 BWI76_RS20455 multifunctional fatty acid oxidation complex subunit alpha
METVSAFTLEVRPDNIAVITIDAPGEKMNTLKAEFASEVRGIIRQIRDNKELRGAVFISA
KPDNFIAGADINMIARCHSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRVCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSGALEMILTGKQLRPRQAL
KAGLVDEVVAQTILLQTAVELALKGRPASRAVPARERILAGPLGRSLLFRLVAKKTHHKT
QGNYPATERILQVMETGLAQGCSSGYAEEARAFGELAMTPQSQALRSIFFASTDLKKDRG
ADAEPVALRSVGILGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLDKQV
RRRYLRASERDRQIGLISGSLDYQGFAHRDVVIEAVFEDLALKQKMVSEVEQHCRPETIF
ASNTSSLPIGEIAAQASRPQRVIGLHFFSPVDKMPLVEVIPHIGTDRQTIATAVKLAKLQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLMEGEPVEHIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAWGERFSPPANIISSILNDDRKGRKNNRGFYLYAAKGRKSKKRPDPA
IYSLLGISSPQARLSEQQVAERCVMMMLNEAARCFDERVVRSARDGDIGAVFGIGFPPFL
GGPFRYMDTLGAGEVAAILQRLAAQYGPRFTPCDTLLHMAEQGATFWPAEERRT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory